Peptídeos
Os peptídeos são cadeias curtas de aminoácidos ligados por ligações peptídicas, desempenhando papéis importantes como moléculas biológicas em processos celulares. Eles funcionam como hormônios, neurotransmissores e moléculas de sinalização, sendo amplamente utilizados em aplicações terapêuticas e diagnósticas. Os peptídeos também são cruciais na pesquisa para estudar interações proteicas, atividades enzimáticas e vias de sinalização celular. Na CymitQuimica, oferecemos uma ampla seleção de peptídeos de alta qualidade para apoiar suas necessidades de pesquisa e desenvolvimento em biotecnologia e farmacêutica.
Ler mais
Subcategorias de "Peptídeos"
Produtos da "Peptídeos"
H-Myr-GSNK^SK^PK-NH2
Peptide H-Myr-GSNK^SK^PK-NH2 is a Research Peptide with significant interest within the field academic and medical …
Ref: 3D-PH00359
| Tamanho indefinido | A consultar |
Entrega estimada em Estados Unidos, Terça-feira 10 de Dezembro de 2024
H-K^CNTA^TCATQRLANFLVHSSNNFGAILSSTNVG^SNTY-NH2
H-KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTY-NH2 is a custom research peptide; min purity 95%, TFA salt. For different specs please …
Ref: 3D-PH00273
| Tamanho indefinido | A consultar |
Entrega estimada em Estados Unidos, Terça-feira 10 de Dezembro de 2024
H-LDLER^-OH
Peptide H-LDLER^-OH is a Research Peptide with significant interest within the field academic and medical …
Ref: 3D-PH00304
| Tamanho indefinido | A consultar |
Entrega estimada em Estados Unidos, Terça-feira 10 de Dezembro de 2024
δ-MSH
Peptide ÎŽ-MSH is a Research Peptide with significant interest within the field academic and medical …
Fórmula:
C74H99N21O16S
Peso molecular:
1,570.81 g/mol
Ref: 3D-PP47636
| Tamanho indefinido | A consultar |
Entrega estimada em Estados Unidos, Terça-feira 10 de Dezembro de 2024
H-FFVPPFQQSPR^-OH
Peptide H-FFVPPFQQSPR^-OH is a Research Peptide with significant interest within the field academic and medical …
Ref: 3D-PH00143
| Tamanho indefinido | A consultar |
Entrega estimada em Estados Unidos, Terça-feira 10 de Dezembro de 2024
H-QFYDQALQQAVVDDDANNAK^-OH
Peptide H-QFYDQALQQAVVDDDANNAK^-OH is a Research Peptide with significant interest within the field academic and medical …
Ref: 3D-PH00392
| Tamanho indefinido | A consultar |
Entrega estimada em Estados Unidos, Terça-feira 10 de Dezembro de 2024
H-DLPAPITR^-OH
Peptide H-DLPAPITR^-OH is a Research Peptide with significant interest within the field academic and medical …
Ref: 3D-PH00089
| Tamanho indefinido | A consultar |
Entrega estimada em Estados Unidos, Terça-feira 10 de Dezembro de 2024
H-NFLINETAR^-OH
Peptide H-NFLINETAR^-OH is a Research Peptide with significant interest within the field academic and medical …
Ref: 3D-PH00366
| Tamanho indefinido | A consultar |
Entrega estimada em Estados Unidos, Terça-feira 10 de Dezembro de 2024
H-YLWEWASVR^-OH
Peptide H-YLWEWASVR^-OH is a Research Peptide with significant interest within the field academic and medical …
Ref: 3D-PH00595
| Tamanho indefinido | A consultar |
Entrega estimada em Estados Unidos, Terça-feira 10 de Dezembro de 2024
H-DFTPAAQAAFQK^-OH
Peptide H-DFTPAAQAAFQK^-OH is a Research Peptide with significant interest within the field academic and medical …
Ref: 3D-PH00080
| Tamanho indefinido | A consultar |
Entrega estimada em Estados Unidos, Terça-feira 10 de Dezembro de 2024
H-G^PSLFPLAPSSK^-OH
Peptide H-G^PSLFPLAPSSK^-OH is a Research Peptide with significant interest within the field academic and medical …
Ref: 3D-PP42563
| Tamanho indefinido | A consultar |
Entrega estimada em Estados Unidos, Terça-feira 10 de Dezembro de 2024
H-HNLFEPEDTGQR^-OH
Peptide H-HNLFEPEDTGQR^-OH is a Research Peptide with significant interest within the field academic and medical …
Ref: 3D-PH00232
| Tamanho indefinido | A consultar |
Entrega estimada em Estados Unidos, Terça-feira 10 de Dezembro de 2024
H-VLPVPQK^-OH
Peptide H-VLPVPQK^-OH is a Research Peptide with significant interest within the field academic and medical …
Ref: 3D-PP48995
| Tamanho indefinido | A consultar |
Entrega estimada em Estados Unidos, Terça-feira 10 de Dezembro de 2024
H-LLDEVTYLEASK^-OH
Peptide H-LLDEVTYLEASK^-OH is a Research Peptide with significant interest within the field academic and medical …
Ref: 3D-PH00323
| Tamanho indefinido | A consultar |
Entrega estimada em Estados Unidos, Terça-feira 10 de Dezembro de 2024
H-EQQCVIMAENR^-OH
Peptide H-EQQCVIMAENR^-OH is a Research Peptide with significant interest within the field academic and medical …
Ref: 3D-PH00127
| Tamanho indefinido | A consultar |
Entrega estimada em Estados Unidos, Terça-feira 10 de Dezembro de 2024
H-MDLEKNYPTPRTSRTC-NH2
Peptide H-MDLEKNYPTPRTSRTC-NH2 is a Research Peptide with significant interest within the field academic and medical …
Ref: 3D-PP43954
| Tamanho indefinido | A consultar |
Entrega estimada em Estados Unidos, Terça-feira 10 de Dezembro de 2024
Ac-RRRRRRRRRRRR-OH
Peptide Ac-RRRRRRRRRRRR-OH is a Research Peptide with significant interest within the field academic and medical …
Ref: 3D-PA00013
| Tamanho indefinido | A consultar |
Entrega estimada em Estados Unidos, Terça-feira 10 de Dezembro de 2024
H-WYQNMIR^-OH
Peptide H-WYQNMIR^-OH is a Research Peptide with significant interest within the field academic and medical …
Ref: 3D-PH00571
| Tamanho indefinido | A consultar |
Entrega estimada em Estados Unidos, Terça-feira 10 de Dezembro de 2024
H-GTFASLSELHCDK^-OH
Peptide H-GTFASLSELHCDK^-OH is a Research Peptide with significant interest within the field academic and medical …
Ref: 3D-PH00212
| Tamanho indefinido | A consultar |
Entrega estimada em Estados Unidos, Terça-feira 10 de Dezembro de 2024
PB-PKKKRKV
Peptide PB-PKKKRKV is a Research Peptide with significant interest within the field academic and medical …
Ref: 3D-PP00001
| Tamanho indefinido | A consultar |
Entrega estimada em Estados Unidos, Terça-feira 10 de Dezembro de 2024
