
beta-Amyloid (1-40) Human
Ref. 3D-CRB1000087
1mg
588,00€
5mg
1.866,00€
100µg
349,00€
500µg
477,00€

Informação sobre produto
Nome:beta-Amyloid (1-40) Human
Sinónimos:
- H-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV-OHAbeta 1-40
Marca:Biosynth
Descrição:Amyloid β-peptide (Aβ) has been identified as the key subunit of the extracellular plaques found in the brains of patients with Alzheimer's disease (AD) and Down's syndrome (DS). Aβ has therefore been extensively studied as a potential target for treatment of AD.Aβ is formed from the cleavage of the large, transmembrane protein- APP (amyloid precursor protein). Cleavage of APP by β- and then γ-secretases results in the formation of Aβ. Aβ can aggregate to produce amyloid-β oligomers, which are thought to be highly neurotoxic. Over time Aβ can further aggregate to produce the characteristic senile plaques present in AD and DS.Aβ can be degraded by enzymes such as neprilysin, insulin degrading enzyme or endothelin converting enzyme. At physiological levels Aβ may be involved in controlling synaptic activity and neuronal survival.Aβ1-40 is a major C terminal variant of amyloid β constituting the most abundant AB peptide in the human brain.
Aviso:Os nossos productos estão destinados exclusivamente para uso em laboratório. Para qualquer outra aplicação, por favor entre em contacto.
Propriedades químicas
Peso molecular:4,329.8 g/mol
Consulta técnica sobre beta-Amyloid (1-40) Human
Por favor, utilize o carrinho para solicitar um orçamento ou uma encomenda
Por favor, utilize o carrinho para solicitar um orçamento ou uma encomenda. Se desejar solicitar um orçamento ou fazer uma encomenda, por favor, adicione os produtos ao seu carrinho e depois solicite um orçamento ou encomenda a partir do carrinho. É mais rápido, mais barato e poderá beneficiar-se dos descontos e outras vantagens disponíveis.