CRAMP (1-39)
Ref. 3D-CRB1000262
1mg
477,00€
500µg
349,00€
Informação sobre produto
Nome:CRAMP (1-39)
Sinónimos:
- H-ISRLAGLLRKGGEKIGEKLKKIGQKIKNFFQKLVPQPEQ-OH
Marca:Biosynth
Descrição:Cathelicidin-related anti-microbial peptide (CRAMP) is the mouse homologue of the human LL-37 anti-microbial peptide. CRAMP possesses potent anti-bacterial activity against Gram-positive and Gram-negative bacterial strains with no haemolytic activity. As well as displaying direct anti-microbial activity, CRAMP also binds to lipopolysaccharide (LPS) to neutralise its activity. CRAMP is encoded for by the Cramp gene which is highly expressed in bone marrow and up-regulated by infectious and inflammatory signals, CRAMP is secreted by cells such as neutrophils epithelial cells and macrophages. This peptide represents the mature, extended, form of CRAMP, longer than the 34 amino acid peptide originally isolated from the bone marrow of mice. CRAMP (1-39) has enhanced anti-microbial activity compared to CRAMP (6-39).
Aviso:Os nossos productos estão destinados exclusivamente para uso em laboratório. Para qualquer outra aplicação, por favor entre em contacto.
Propriedades químicas
Peso molecular:4,419.27 g/mol
Consulta técnica sobre CRAMP (1-39)
Por favor, utilize o carrinho para solicitar um orçamento ou uma encomenda
Por favor, utilize o carrinho para solicitar um orçamento ou uma encomenda. Se desejar solicitar um orçamento ou fazer uma encomenda, por favor, adicione os produtos ao seu carrinho e depois solicite um orçamento ou encomenda a partir do carrinho. É mais rápido, mais barato e poderá beneficiar-se dos descontos e outras vantagens disponíveis.