CymitQuimica logo

Biotin-β Amyloid (1-42) Human

Ref. 3D-CRB1000486

100µg
386,00€
500µg
470,00€
Biotin-β Amyloid (1-42) Human
Biosynth

Informação sobre produto

Nome:Biotin-β Amyloid (1-42) Human
Sinónimos:
  • Biot-(Ahx)DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA-OHBiotin-Ahx-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA-acidBiotin-Ahx-Asp-Al a-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Ly s-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Ser-Asn-Lys-Gly-Ala-Ile
Marca:Biosynth
Descrição:Amyloid β-protein (Aβ) has been identified as the key subunit of the extracellular plaques found in the brains of patients with Alzheimer's disease (AD) and Down's syndrome (DS). Aβ has therefore been extensively studied as a potential target for treatment of AD.Aβ is formed from the cleavage of the large, transmembrane protein- APP (amyloid precursor protein). Cleavage of APP by β- and then γ-secretases results in the formation of Aβ. Aβ can aggregate to produce amyloid-β oligomers, which are thought to be highly neurotoxic. Over time Aβ can further aggregate to produce the characteristic senile plaques present in AD and DS. Aβ can be degraded by enzymes such as neprilysin, insulin degrading enzyme or endothelin converting enzyme. At physiological levels Aβ may be involved in controlling synaptic activity and neuronal survival.This peptide contains a covalently attached N-Terminal biotin tag for convenient detection and purification.
Aviso:Os nossos productos estão destinados exclusivamente para uso em laboratório. Para qualquer outra aplicação, por favor entre em contacto.

Propriedades químicas

Pureza:Min. 95%
Cor/forma:Powder

Consulta técnica sobre Biotin-β Amyloid (1-42) Human

Por favor, utilize o carrinho para solicitar um orçamento ou uma encomenda

Por favor, utilize o carrinho para solicitar um orçamento ou uma encomenda. Se desejar solicitar um orçamento ou fazer uma encomenda, por favor, adicione os produtos ao seu carrinho e depois solicite um orçamento ou encomenda a partir do carrinho. É mais rápido, mais barato e poderá beneficiar-se dos descontos e outras vantagens disponíveis.
◻️
CYMIT QUÍMICA, S.L., como responsável pelo tratamento, tratará os seus dados a fim de responder às suas consultas ou solicitações. Poderá aceder, rectificar e apagar os seus dados, bem como exercer outros direitos ao consultar as informações adicionais e detalhadas sobre protecção de dados na nossa Política de Privacidade do Website.
* Campos obrigatórios.