CymitQuimica logo

Histone H3.2 (1-44)

Ref. 3D-CRB1000587

500µg
386,00€
1mg
470,00€
Histone H3.2 (1-44)
Biosynth

Informação sobre produto

Nome:Histone H3.2 (1-44)
Sinónimos:
  • H-ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPG-OH
Marca:Biosynth
Descrição:Histone H3.2 is a highly common variant of the core histone H3 which is found in all eukaryotes except budding yeast. H3.2 is replication-dependent and is associated with gene silencing. Histone variants can replace canonical histones in certain cells or stages of development and help regulate numerous nuclear processes including transcription, DNA repair and chromosome segregation.Histone 3 (H3) which is one of the four core histones (H2A, H2B, H3 and H4) fundamental in compacting eukaryotic DNA into the nucleosome. Both H4 and H3 are highly conserved and perform roles in binding to segments of DNA which enter and leave the nucleosome and in chromatin formation. Similar to the other core histone, H3 has a globular domain and a flexible N-terminal domain, 'histone tail' which can undergo modifications such as acetylation, methylation, phosphorylation and ubiquitination.
Aviso:Os nossos productos estão destinados exclusivamente para uso em laboratório. Para qualquer outra aplicação, por favor entre em contacto.

Propriedades químicas

Peso molecular:4,668.7 g/mol

Consulta técnica sobre Histone H3.2 (1-44)

Por favor, utilize o carrinho para solicitar um orçamento ou uma encomenda

Por favor, utilize o carrinho para solicitar um orçamento ou uma encomenda. Se desejar solicitar um orçamento ou fazer uma encomenda, por favor, adicione os produtos ao seu carrinho e depois solicite um orçamento ou encomenda a partir do carrinho. É mais rápido, mais barato e poderá beneficiar-se dos descontos e outras vantagens disponíveis.
◻️
CYMIT QUÍMICA, S.L., como responsável pelo tratamento, tratará os seus dados a fim de responder às suas consultas ou solicitações. Poderá aceder, rectificar e apagar os seus dados, bem como exercer outros direitos ao consultar as informações adicionais e detalhadas sobre protecção de dados na nossa Política de Privacidade do Website.
* Campos obrigatórios.