
[Cys]-Exendin 4
Ref. 3D-CRB1000606
1mg
470,00€
500µg
386,00€

Informação sobre produto
Nome:[Cys]-Exendin 4
Sinónimos:
- H-CHGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2
Marca:Biosynth
Descrição:Originally identified in Gila monster lizard (Heloderma suspectum), Exendin-4 is an incretin mimetic, an analog of glucagon-like-peptide-1 (GLP-1), it stimulates insulin secretion and modulates gastric emptying to slow the entry of ingested sugars into the bloodstream. Exendin-4 is resistant to cleavage by plasma DPP-IV unlike GLP-1. This gives it a longer half-life and duration of action than GLP-1, as well as greater potency in vivo. Exendin-4 increases insulin sensitivity and improves glucose tolerance and is currently used for the treatment of Type 2 diabetes mellitus in its synthetic form Exenatide.Exendin-4 also promotes the production and proliferation of β-cells leading to regeneration of the pancreas. It is a ligand to the exendin receptor and increases pancreatic acinar cell cAMP levels. However, the GLP-1 analog was found to have a toxic effect by inducing hypotension due to relaxation of the cardiac smooth muscle.This exendin-4 peptide is provided with an N-terminal cysteine residue for conjugation reactions.
Aviso:Os nossos productos estão destinados exclusivamente para uso em laboratório. Para qualquer outra aplicação, por favor entre em contacto.
Propriedades químicas
Peso molecular:4,287 g/mol
Consulta técnica sobre [Cys]-Exendin 4
Por favor, utilize o carrinho para solicitar um orçamento ou uma encomenda
Por favor, utilize o carrinho para solicitar um orçamento ou uma encomenda. Se desejar solicitar um orçamento ou fazer uma encomenda, por favor, adicione os produtos ao seu carrinho e depois solicite um orçamento ou encomenda a partir do carrinho. É mais rápido, mais barato e poderá beneficiar-se dos descontos e outras vantagens disponíveis.