CymitQuimica logo

LL-37 amide

CAS:

Ref. 3D-CRB1000864

500µg
386,00€
1mg
470,00€
LL-37 amide
Biosynth

Informação sobre produto

Nome:LL-37 amide
Sinónimos:
  • H-LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES-NH2LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES-amideH-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Gl u-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gl n-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-NH2
Marca:Biosynth
Descrição:LL-37 is a member of the large cationic family of anti-microbial peptides called cathelicidins which have broad-spectrum anti-microbial activity and are expressed in many species. The only cathelicidin found in humans is LL-37, this is produced in epithelial cells, by proteolytic cleavage from the C-terminal of the hCAP-18 protein. LL-37 can be processed into different forms of anti-microbial peptides. As well as its anti-microbial properties LL-37 also regulates many aspects of the innate immune system and overexpression of LL-37 has been linked to autoimmune diseases such as asthma and psoriasis, making LL-37 the most studied form of the human cathelicidin peptides.More recently, studies have shown that LL-37 binds to SARS-CoV-2 S protein and inhibits binding to its receptor hACE2, which may inhibit viral entry into the cell. LL-37 is upregulated by vitamin D, therefore this may be one mode of action for the positive outcomes seen with vitamin D treatment for Covid-19.
Aviso:Os nossos productos estão destinados exclusivamente para uso em laboratório. Para qualquer outra aplicação, por favor entre em contacto.

Propriedades químicas

Peso molecular:4,493.3 g/mol
Fórmula:C205H341N61O52

Consulta técnica sobre LL-37 amide

Por favor, utilize o carrinho para solicitar um orçamento ou uma encomenda

Por favor, utilize o carrinho para solicitar um orçamento ou uma encomenda. Se desejar solicitar um orçamento ou fazer uma encomenda, por favor, adicione os produtos ao seu carrinho e depois solicite um orçamento ou encomenda a partir do carrinho. É mais rápido, mais barato e poderá beneficiar-se dos descontos e outras vantagens disponíveis.
◻️
CYMIT QUÍMICA, S.L., como responsável pelo tratamento, tratará os seus dados a fim de responder às suas consultas ou solicitações. Poderá aceder, rectificar e apagar os seus dados, bem como exercer outros direitos ao consultar as informações adicionais e detalhadas sobre protecção de dados na nossa Política de Privacidade do Website.
* Campos obrigatórios.