Informação sobre produto
- H-KWKVFKKIEKMGRNIRNGIVKAGPAIAVLGEAKAL-NH2H-Lys-Trp-Lys-Val-Phe-Lys-Lys-Ile-Glu-Lys-Met-Gly-Arg-Asn-Ile-Arg-Asn-Gly-Ile-Val-Lys-Ala- Gly-Pro-Ala-Ile-Ala-Val-Leu-Gly-Glu-Ala-Ly s-Ala-Leu-NH2CEF20
- Cytomegalovirus
- CMV pp65 (495-503)
- H-Lys-Trp-Lys-Val-Phe-Lys-Lys-Ile-Glu-Lys-Met-Gly-Arg-Asn-Ile-Arg-Asn-Gly-Ile-Val-Lys-Ala-Gly-Pro-Ala-Ile-Ala-Val-Leu-Gly-Glu-Ala-Lys-Ala-Leu-NH2
Cecropins are a lytic peptide family, originally isolated from Hyalophora cecropia. Cecropin-B is a cationic helical peptide that can form pores, this is believed to be the reason for its such potent lytic activity. Cecropin-B has been shown to be effective against both Gram-positive and Gram-negative bacteria plus numerous cancer cell lines including multidrug-resistant types. The ability to insert into the cell membrane and lead to pore formation is attributed to the amphipathic groups present creating amphipathic regions. The effectiveness of cecropin-B on cancer cells has led to further use of the peptide as a model for potential new anticancer drugs including cyclic cationic forms.
Propriedades químicas
Consulta técnica sobre: 3D-CRB1001130 Cecropin-B
Se desejar solicitar um orçamento ou fazer uma encomenda, por favor, adicione os produtos ao seu carrinho e depois solicite um orçamento ou encomenda a partir do carrinho. É mais rápido, mais barato e poderá beneficiar-se dos descontos e outras vantagens disponíveis.
