CymitQuimica logo

Biotin BRC4 (1517-1551)

Ref. 3D-CRB1001302

1mg
470,00€
500µg
386,00€
Biotin BRC4 (1517-1551)
Biosynth

Informação sobre produto

Nome:Biotin BRC4 (1517-1551)
Sinónimos:
  • Biot-(Ahx)KEPTLLGFHTASGKKVKIAKESLDKVKNLFDEKEQ-NH2Biotin-Ahx-KEPTLLGFHTASGKKVKIAKESLDKVKNLFDEKEQ-amideBiotin-Ahx-Lys-Glu-Pro-Thr-Le u-Leu-Gly-Phe-His-Thr-Ala-Ser-Gly-Lys-Lys-Val-Lys- Ile-Ala-Lys-Glu-Ser-Leu-Asp-Lys-Val-Lys-Asn-Leu-Phe-Asp-Glu-Lys-Glu-Gln
Marca:Biosynth
Descrição:Human BRCA2 is a key contributor to DNA damage repair and thus genomic integrity. Along with RAD51, BRCA2 ensures accurate and timely progression of homologous recombination (HR) at sites of double strand breaks to facilitate repair. BRCA2 also has an important additional function at the replication fork. BRCA2 therefore has anti-tumour properties and mutations in human BRCA2 protein cause a predisposition to breast and ovarian cancers and increase susceptibility to other tumorigenic conditions.BRCA2 interacts with RAD51 through a series of eight motifs called BRC repeats and a separate binding site located in the C-terminal region. Among eight BRC repeats involved in RAD51 binding, BRC4 displays the highest affinity for RAD51. The BRC4-RAD51 interaction may inhibit RAD51 oligomerization. Low concentrations of BRC4 enhance RAD51 binding to single stranded DNA and stimulate RAD51-mediated strand exchange, high concentrations of BRC4 disrupt RAD51 filament formation. Contains an N-terminal biotin tag for easy detection and purification.
Aviso:Os nossos productos estão destinados exclusivamente para uso em laboratório. Para qualquer outra aplicação, por favor entre em contacto.

Propriedades químicas

Peso molecular:4,293.4 g/mol

Consulta técnica sobre Biotin BRC4 (1517-1551)

Por favor, utilize o carrinho para solicitar um orçamento ou uma encomenda

Por favor, utilize o carrinho para solicitar um orçamento ou uma encomenda. Se desejar solicitar um orçamento ou fazer uma encomenda, por favor, adicione os produtos ao seu carrinho e depois solicite um orçamento ou encomenda a partir do carrinho. É mais rápido, mais barato e poderá beneficiar-se dos descontos e outras vantagens disponíveis.
◻️
CYMIT QUÍMICA, S.L., como responsável pelo tratamento, tratará os seus dados a fim de responder às suas consultas ou solicitações. Poderá aceder, rectificar e apagar os seus dados, bem como exercer outros direitos ao consultar as informações adicionais e detalhadas sobre protecção de dados na nossa Política de Privacidade do Website.
* Campos obrigatórios.