CymitQuimica logo

TAT-GSK'364A

Ref. 3D-CRB1001425

500µg
386,00€
1mg
470,00€
TAT-GSK'364A
Biosynth

Informação sobre produto

Nome:TAT-GSK'364A
Sinónimos:
  • H-RKKRRQRRRAQAKVFGAGYPSLPTMTVSDWYEQHRKYG-OHRKKRRQRRRAQAKVFGAGYPSLP™TVSDWYEQHRKYG-acidH-Arg-Lys-Lys-Arg-Arg-Gln-Arg-Arg-Arg-Ala-Gln -Ala-Lys-Val-Phe-Gly-Ala-Gly-Tyr-Pro-Ser-Leu -Pro-Thr-Met-Thr-Val-Ser-Asp-Trp-Tyr-Glu-Gln-His-Arg-Lys-Tyr-Gly-OH
Marca:Biosynth
Descrição:TAT-GSK'364A peptide is able to specifically mimic the binding sequence between Midline-1 (MID1) and the protein phosphatase 2A (PP2A) alpha4 complex and therefore can specifically outcompete MID1 from binding to alpha4-PP2Ac. TAT-GSK'364A therefore is useful in studying Alzheimer's disease (AD). AD is characterized by senile plaques, composed of amyloid-β (Aβ) peptides, derived from sequential proteolytic cleavage of the amyloid precursor protein (APP), and neurofibrillary tangles, composed of hyperphosphorylated tau protein.MID1 protein induces the translation of amyloid precursor protein (APP) mRNA via mTOR-eIF signalling and binds to PP2A to form the MID1-PP2A complex. PP2A is the main tau phosphatase and MID1 is a negative regulator of PP2A activity as it acts as an E3 ubiquitin ligase to promote the ubiquitin-dependent degradation of PP2A.GSK'364A contains 29-residue sequence from the alpha4 subunit (AQAKVFGAGYPSLPTMTVSDWYEQHRKYG) with an N-terminal sequence derived from HIV-TAT protein (RKKRRQRRR).
Aviso:Os nossos productos estão destinados exclusivamente para uso em laboratório. Para qualquer outra aplicação, por favor entre em contacto.

Propriedades químicas

Peso molecular:4,607.4 g/mol

Consulta técnica sobre TAT-GSK'364A

Por favor, utilize o carrinho para solicitar um orçamento ou uma encomenda

Por favor, utilize o carrinho para solicitar um orçamento ou uma encomenda. Se desejar solicitar um orçamento ou fazer uma encomenda, por favor, adicione os produtos ao seu carrinho e depois solicite um orçamento ou encomenda a partir do carrinho. É mais rápido, mais barato e poderá beneficiar-se dos descontos e outras vantagens disponíveis.
◻️
CYMIT QUÍMICA, S.L., como responsável pelo tratamento, tratará os seus dados a fim de responder às suas consultas ou solicitações. Poderá aceder, rectificar e apagar os seus dados, bem como exercer outros direitos ao consultar as informações adicionais e detalhadas sobre protecção de dados na nossa Política de Privacidade do Website.
* Campos obrigatórios.