
Ghrelin-[Cys(AF647)] Human
Ref. 3D-CRB1110382
100µg
386,00€
500µg
470,00€
1mg
543,00€

Informação sobre produto
Nome:Ghrelin-[Cys(AF647)] Human
Sinónimos:
- H-GSSFLSPEHQRVQQRKESKKPPAKLQPR(C/AF647)-NH2GSSFLSPEHQRVQQRKESKKPPAKLQPR-[Cys(AF647)]-amideH-Gly-Ser-Ser-Phe-Leu-Ser-Pro-Glu-His-Gl n-Arg-Val-Gln-Gln-Arg-Lys-Glu-Ser-Lys-Lys-Pr o-Pro-Ala-Lys-Leu-Gln-Pro-Arg-[Cys(AF647)]-NH2
Marca:Biosynth
Descrição:Ghrelin is a peptide hormone mainly produced in the stomach. Ghrelin is involved in several physiological processes, including feeding, lipid accumulation, stress response- anxiety- cardiac performance- immunity and inflammation, taste sensation, reward-seeking behaviour, glucose metabolism and thermogenesis, memory, motivation and learning.Ghrelin exerts its actions by binding the growth hormone secretagogue receptor (GHSR), mainly found in the hypothalamic and mesolimbic brain regions and peripheral organs (adipose tissue, adrenals, and stomach).Ghrelin is produced by the cleavage of the precursor peptide preproghrelin. The attachment of a fatty acid to its serine 3 residue makes a form capable of activating GHSR.Ghrelin is a valuable target for treating conditions such as anorexia, cachexia, sarcopenia, cardiopathy, neurodegenerative disorders, renal and pulmonary disease, gastrointestinal disorders, inflammatory disorders and metabolic syndrome.This ghrelin has a C-terminal AF647, a structural analog to Alexa Fluor 647, a widely used far-red fluorescent dye. Its excitation is ideally suited to 594nm or 633nm. This dye is suited for low abundance targets as it has high initial brightness and a high photostability allowing detection of low abundance peptides.
Aviso:Os nossos productos estão destinados exclusivamente para uso em laboratório. Para qualquer outra aplicação, por favor entre em contacto.
Propriedades químicas
Peso molecular:4,326.9 g/mol
Pureza:Min. 95%
Consulta técnica sobre Ghrelin-[Cys(AF647)] Human
Por favor, utilize o carrinho para solicitar um orçamento ou uma encomenda
Por favor, utilize o carrinho para solicitar um orçamento ou uma encomenda. Se desejar solicitar um orçamento ou fazer uma encomenda, por favor, adicione os produtos ao seu carrinho e depois solicite um orçamento ou encomenda a partir do carrinho. É mais rápido, mais barato e poderá beneficiar-se dos descontos e outras vantagens disponíveis.