Ghrelin-[Cys(AF647)] Human

Ref. 3D-CRB1110382

Informação sobre produto

• Nome: Ghrelin-[Cys(AF647)] Human
• Sinónimos: H-GSSFLSPEHQRVQQRKESKKPPAKLQPR(C/AF647)-NH2GSSFLSPEHQRVQQRKESKKPPAKLQPR-[Cys(AF647)]-amideH-Gly-Ser-Ser-Phe-Leu-Ser-Pro-Glu-His-Gl n-Arg-Val-Gln-Gln-Arg-Lys-Glu-Ser-Lys-Lys-Pr o-Pro-Ala-Lys-Leu-Gln-Pro-Arg-[Cys(AF647)]-NH2
• Marca: Biosynth
• Descrição: Ghrelin is a peptide hormone mainly produced in the stomach. Ghrelin is involved in several physiological processes, including feeding, lipid accumulation, stress response- anxiety- cardiac performance- immunity and inflammation, taste sensation, reward-seeking behaviour, glucose metabolism and thermogenesis, memory, motivation and learning.Ghrelin exerts its actions by binding the growth hormone secretagogue receptor (GHSR), mainly found in the hypothalamic and mesolimbic brain regions and peripheral organs (adipose tissue, adrenals, and stomach).Ghrelin is produced by the cleavage of the precursor peptide preproghrelin. The attachment of a fatty acid to its serine 3 residue makes a form capable of activating GHSR.Ghrelin is a valuable target for treating conditions such as anorexia, cachexia, sarcopenia, cardiopathy, neurodegenerative disorders, renal and pulmonary disease, gastrointestinal disorders, inflammatory disorders and metabolic syndrome.This ghrelin has a C-terminal AF647, a structural analog to Alexa Fluor 647, a widely used far-red fluorescent dye. Its excitation is ideally suited to 594nm or 633nm. This dye is suited for low abundance targets as it has high initial brightness and a high photostability allowing detection of low abundance peptides.

Propriedades químicas

• Peso molecular: 4,326.9 g/mol
• Pureza: Min. 95%