(Asn7)-Amyloid b-Protein (1-40) trifluoroacetate salt
CAS: 131438-79-4
Ref. 3D-FA110057
1mg | 514,00 € | ||
2mg | 843,00 € | ||
5mg | 1.553,00 € | ||
10mg | 2.785,00 € | ||
500µg | 336,00 € |
Informação sobre produto
- H-Asp-Ala-Glu-Phe-Arg-His-Asn-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe- Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-G ly-Leu-Met-Val-Gly-Gly-Val-Val-OH H-DAEFRHNSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV-OH
- L-Valine,L-a-aspartyl-L-alanyl-L-a-glutamyl-L-phenylalanyl-L-arginyl-L-histidyl-L-a-aspartyl-L-serylglycyl-L-tyrosyl-L-a-glutamyl-L-valyl-L-histidyl-L-histidyl-L-glutaminyl-L-lysyl-L-leucyl-L-valyl-L-phenylalanyl-L-phenylalanyl-L-alanyl-L-a-glutamyl-L-a-aspartyl-L-valylglycyl-L-seryl-L-asparaginyl-L-lysylglycyl-L-alanyl-L-isoleucyl-L-isoleucylglycyl-L-leucyl-L-methionyl-L-valylglycylglycyl-L-valyl-
- Amyloidb-peptide(1-40)(human)
- H-asp-ala-glu-phe-gly-his-asp-ser-gly-phe-glu-val-arg-his-asp-ser-gly-phe-glu-val-arg-his-gln-lys-leu-val-gly-phe-phe-ala-glu-asp-val-gly-ser-asn-lys-gly-ala-ile-ile-gly-leu-met-val-gly-gly-val-val-oh
- ss-Amyloid (1-40), rat
- Beta-Amyloid Protein(1-40)
- Beta-Amyloid 1-40,human
- Abeta 1-40
- β-Amyloid(1-40)Human
(Asn7)-Amyloid b-Protein (1-40) trifluoroacetate salt H-Asp-Ala-Glu-Phe-Arg-His-Asn-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys
The product is a compound that has been shown to inhibit the formation of beta amyloid peptides in the brain. It binds to the beta amyloid peptide and prevents its aggregation, thereby preventing the formation of plaques and inhibiting neuronal cell death. The product contains no detectable levels of trehalose, which makes it ideal for use in brain imaging studies. This product may also be used as a predictive biomarker for Alzheimer's disease because it can be detected in cerebrospinal fluid and plasma.
Propriedades químicas
Consulta técnica sobre: 3D-FA110057 (Asn7)-Amyloid b-Protein (1-40) trifluoroacetate salt
Se desejar solicitar um orçamento ou fazer uma encomenda, por favor, adicione os produtos ao seu carrinho e depois solicite um orçamento ou encomenda a partir do carrinho. É mais rápido, mais barato e poderá beneficiar-se dos descontos e outras vantagens disponíveis.