Amyloid beta-Protein (1-37) trifluoroacetate salt
CAS: 186359-67-1
Ref. 3D-FA110115
1mg | 729,00 € | ||
2mg | 1.114,00 € | ||
5mg | 2.410,00 € | ||
250µg | 286,00 € | ||
500µg | 470,00 € |
Informação sobre produto
- H-Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe- Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-G ly-Leu-Met-Val-Gly-OH H-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVG-OH
Please enquire for more information about Amyloid beta-Protein (1-37) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page
Propriedades químicas
Consulta técnica sobre: 3D-FA110115 Amyloid beta-Protein (1-37) trifluoroacetate salt
Se desejar solicitar um orçamento ou fazer uma encomenda, por favor, adicione os produtos ao seu carrinho e depois solicite um orçamento ou encomenda a partir do carrinho. É mais rápido, mais barato e poderá beneficiar-se dos descontos e outras vantagens disponíveis.