Amyloid b-Protein (1-40) amide trifluoroacetate salt
CAS: 203460-31-5
Ref. 3D-FA110204
1mg | 502,00 € | ||
2mg | 820,00 € | ||
5mg | 1.500,00 € | ||
10mg | 2.571,00 € | ||
500µg | 343,00 € |
Informação sobre produto
- H-Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gl y-Leu-Met-Val-Gly-Gly-Val-Val-NH2 H-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV-NH2
Please enquire for more information about Amyloid b-Protein (1-40) amide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page
Propriedades químicas
Consulta técnica sobre: 3D-FA110204 Amyloid b-Protein (1-40) amide trifluoroacetate salt
Se desejar solicitar um orçamento ou fazer uma encomenda, por favor, adicione os produtos ao seu carrinho e depois solicite um orçamento ou encomenda a partir do carrinho. É mais rápido, mais barato e poderá beneficiar-se dos descontos e outras vantagens disponíveis.