Amyloid beta-Protein (3-40) trifluoroacetate salt
CAS: 157884-70-3
Ref. 3D-FA110208
1mg | 497,00 € | ||
2mg | 729,00 € | ||
5mg | 1.339,00 € | ||
10mg | 2.249,00 € | ||
500µg | 308,00 € |
Informação sobre produto
- H-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu- Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-M et-Val-Gly-Gly-Val-Val-OH H-EFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV-OH
Please enquire for more information about Amyloid beta-Protein (3-40) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page
Propriedades químicas
Consulta técnica sobre: 3D-FA110208 Amyloid beta-Protein (3-40) trifluoroacetate salt
Se desejar solicitar um orçamento ou fazer uma encomenda, por favor, adicione os produtos ao seu carrinho e depois solicite um orçamento ou encomenda a partir do carrinho. É mais rápido, mais barato e poderá beneficiar-se dos descontos e outras vantagens disponíveis.