Big Endothelin-3 (1-41) amide (human) trifluoroacetate salt
CAS: 133551-97-0
Ref. 3D-FB110162
10mg | 1.822,00 € | ||
25mg | 2.429,00 € | ||
50mg | 3.037,00 € | ||
100mg | 4.251,00 € | ||
250mg | 6.073,00 € |
Informação sobre produto
- H-CTCFTYKDKECVYYCHLDIIWINTPEQTVPYGLSNYRGSFR-NH2
Big endothelin-3 is a peptide that is a potent inhibitor of the endothelin receptor. It has been shown to inhibit the binding of endothelin to its receptors and antagonize the effects of endothelin on cells. Big endothelin-3 is a research tool for studying protein interactions, activators, and ligands. This product is the ammonium acetate salt form.
Propriedades químicas
Consulta técnica sobre: 3D-FB110162 Big Endothelin-3 (1-41) amide (human) trifluoroacetate salt
Se desejar solicitar um orçamento ou fazer uma encomenda, por favor, adicione os produtos ao seu carrinho e depois solicite um orçamento ou encomenda a partir do carrinho. É mais rápido, mais barato e poderá beneficiar-se dos descontos e outras vantagens disponíveis.