Cys-Gly-Lys-Arg-Amyloid b-Protein (1-42)
CAS: 1802086-21-0
Ref. 3D-FC109823
1mg | 497,00 € | ||
2mg | 729,00 € | ||
5mg | 1.500,00 € | ||
250µg | 195,00 € | ||
500µg | 308,00 € |
Informação sobre produto
- H-Cys-Gly-Lys-Arg-Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gl y-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val-Ile-Ala-OH H-CGKRDAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA-OH
Please enquire for more information about Cys-Gly-Lys-Arg-Amyloid b-Protein (1-42) including the price, delivery time and more detailed product information at the technical inquiry form on this page
Propriedades químicas
Consulta técnica sobre: 3D-FC109823 Cys-Gly-Lys-Arg-Amyloid b-Protein (1-42)
Se desejar solicitar um orçamento ou fazer uma encomenda, por favor, adicione os produtos ao seu carrinho e depois solicite um orçamento ou encomenda a partir do carrinho. É mais rápido, mais barato e poderá beneficiar-se dos descontos e outras vantagens disponíveis.