Gastric Inhibitory Polypeptide (1-30) amide (porcine)
CAS: 134846-93-8
Ref. 3D-FG109097
1mg | 922,00 € | ||
2mg | 1.478,00 € | ||
5mg | 3.213,00 € | ||
250µg | 359,00 € | ||
500µg | 556,00 € |
Informação sobre produto
- H-Tyr-Ala-Glu-Gly-Thr-Phe-Ile-Ser-Asp-Tyr-Ser-Ile-Ala-Met-Asp-Lys-Ile-Arg-Gln- Gln-Asp-Phe-Val-Asn-Trp-Leu-Leu-Ala-Gln-Lys-NH2 H-YA EGTFISDYSIAMDKIRQQDFVNWLLAQK-NH2
Please enquire for more information about Gastric Inhibitory Polypeptide (1-30) amide (porcine) including the price, delivery time and more detailed product information at the technical inquiry form on this page
Propriedades químicas
Consulta técnica sobre: 3D-FG109097 Gastric Inhibitory Polypeptide (1-30) amide (porcine)
Se desejar solicitar um orçamento ou fazer uma encomenda, por favor, adicione os produtos ao seu carrinho e depois solicite um orçamento ou encomenda a partir do carrinho. É mais rápido, mais barato e poderá beneficiar-se dos descontos e outras vantagens disponíveis.