(Gln9)-Amyloid b-Protein (1-40) trifluoroacetate salt
CAS: 1802084-59-8
Ref. 3D-FG109838
1mg | 289,00 € | ||
2mg | 460,00 € | ||
5mg | 781,00 € | ||
10mg | 1.248,00 € | ||
25mg | 2.713,00 € |
Informação sobre produto
- H-Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gln-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe- Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-G ly-Leu-Met-Val-Gly-Gly-Val-Val-OH H-DAEFRHDSQYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV-OH
Please enquire for more information about (Gln9)-Amyloid b-Protein (1-40) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page
Propriedades químicas
Consulta técnica sobre: 3D-FG109838 (Gln9)-Amyloid b-Protein (1-40) trifluoroacetate salt
Se desejar solicitar um orçamento ou fazer uma encomenda, por favor, adicione os produtos ao seu carrinho e depois solicite um orçamento ou encomenda a partir do carrinho. É mais rápido, mais barato e poderá beneficiar-se dos descontos e outras vantagens disponíveis.