(Nle 35)-Amyloid b-Protein (1-40) ammonium salt
CAS: 1802086-31-2
Ref. 3D-FN110048
1mg | 329,00 € | ||
2mg | 478,00 € | ||
5mg | 911,00 € | ||
10mg | 1.500,00 € | ||
500µg | 193,00 € |
Informação sobre produto
- H-Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gl y-Leu-Nle-Val-Gly-Gly-Val-Val-OH H-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGL(Nle)VGGVV-OH
Please enquire for more information about (Nle 35)-Amyloid b-Protein (1-40) ammonium salt including the price, delivery time and more detailed product information at the technical inquiry form on this page
Propriedades químicas
Consulta técnica sobre: 3D-FN110048 (Nle 35)-Amyloid b-Protein (1-40) ammonium salt
Se desejar solicitar um orçamento ou fazer uma encomenda, por favor, adicione os produtos ao seu carrinho e depois solicite um orçamento ou encomenda a partir do carrinho. É mais rápido, mais barato e poderá beneficiar-se dos descontos e outras vantagens disponíveis.