PACAP-38 (human, mouse, ovine, porcine, rat) trifluoroacetate salt
CAS: 124123-15-5
Ref. 3D-FP110313
1mg | 1.211,00 € | ||
2mg | 2.121,00 € | ||
100µg | 338,00 € | ||
250µg | 448,00 € | ||
500µg | 740,00 € |
Informação sobre produto
- H-His-Ser-Asp-Gly-Ile-Phe-Thr-Asp-Ser-Tyr-Ser-Arg-Tyr-Arg-Lys-Gln -Met-Ala-Val-Lys-Lys-Tyr-Leu-Ala-Ala-Val-Leu-Gly-Lys-Arg-Tyr-Lys-G ln-Arg-Val-Lys-Asn-Lys-NH2 H-HSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK-NH2
- H-His-Ser-Asp-Gly-Ile-Phe-Thr-Asp-Ser-Tyr-Ser-Arg-Tyr-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Ala-Ala-Val-Leu-Gly-Lys-Arg-Tyr-Lys-Gln-Arg-Val-Lys-Asn-Lys-NH2
PACAP-38 is a peptide that has been shown to have a variety of physiological effects, including the regulation of brain functions and immunological responses. PACAP-38 has been found to bind to toll-like receptor 4 (TLR4) in macrophages and neutrophils, which stimulates the production of proinflammatory cytokines. It also interacts with adenylate cyclase, which leads to an increase in cAMP levels. This may be the mechanism by which PACAP-38 regulates brain functions. The biological function of PACAP-38 is not yet clear but it may act as a signal peptide, regulating protein synthesis and gene expression.
Propriedades químicas
Consulta técnica sobre: 3D-FP110313 PACAP-38 (human, mouse, ovine, porcine, rat) trifluoroacetate salt
Se desejar solicitar um orçamento ou fazer uma encomenda, por favor, adicione os produtos ao seu carrinho e depois solicite um orçamento ou encomenda a partir do carrinho. É mais rápido, mais barato e poderá beneficiar-se dos descontos e outras vantagens disponíveis.