Peptide YY (human) trifluoroacetate salt
CAS: 118997-30-1
Ref. 3D-FP110394
1mg | 717,00 € | ||
2mg | 1.157,00 € | ||
5mg | 2.517,00 € | ||
250µg | 300,00 € | ||
500µg | 483,00 € |
Informação sobre produto
- H-Tyr-Pro-Ile-Lys-Pro-Glu-Ala-Pro-Gly-Glu-Asp-Ala-Ser-Pro-Glu-Glu-Leu-Asn-Arg-Tyr-Tyr-Ala-Ser-Leu-Arg-His-Tyr-Leu-Asn-Leu-Val-Thr-Ar g-Gln-Arg-Tyr-NH2 H-YPIKPEAPGEDASPEELNRYYASLRHYLNLVTRQRY-NH2
- H-Tyr-Pro-Ile-Lys-Pro-Glu-Ala-Pro-Gly-Glu-Asp-Ala-Ser-Pro-Glu-Glu-Leu-Asn-Arg-Tyr-Tyr-Ala-Ser-Leu-Arg-His-Tyr-Leu-Asn-Leu-Val-Thr-Arg-Gln-Arg-Tyr-NH2
Peptide YY (PYY) is a 36-amino acid peptide that is secreted by the gut. PYY is a potent inhibitor of food intake and glucose homeostasis in rats and may be involved in the regulation of lipid metabolism. The trifluoroacetate salt form of PYY has been shown to have improved solubility, stability, and bioavailability. It has also been found to be more selective for the PYY receptor than other forms of PYY. The trifluoroacetate salt form of PYY remains stable to phase chromatography under acidic conditions but degrades at higher pH levels.
Propriedades químicas
Consulta técnica sobre: 3D-FP110394 Peptide YY (human) trifluoroacetate salt
Se desejar solicitar um orçamento ou fazer uma encomenda, por favor, adicione os produtos ao seu carrinho e depois solicite um orçamento ou encomenda a partir do carrinho. É mais rápido, mais barato e poderá beneficiar-se dos descontos e outras vantagens disponíveis.