
5-TAMRA-Amyloid β-Protein (1-40) trifluoroacetate salt
CAS: 1802087-81-5
Ref. 3D-FT110109
1mg | 5.924,00 € |
Informação sobre produto
- 5-TAMRA-Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile- Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val-OH 5TAMRA-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV-OH
Please enquire for more information about 5-TAMRA-Amyloid beta-Protein (1-40) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page
Propriedades químicas
Consulta técnica sobre: 3D-FT110109 5-TAMRA-Amyloid β-Protein (1-40) trifluoroacetate salt
Se desejar solicitar um orçamento ou fazer uma encomenda, por favor, adicione os produtos ao seu carrinho e depois solicite um orçamento ou encomenda a partir do carrinho. É mais rápido, mais barato e poderá beneficiar-se dos descontos e outras vantagens disponíveis.