
OD1 Toxin
Ref. 3D-ODT-3866-PI
1mg
4.454,00€

Informação sobre produto
Nome:OD1 Toxin
Sinónimos:
- GVRDAYIADDKNCVYTCASNGYCNTECTKNGAESGYCQWIGRYGNACWCIKLPDEVPIRIPGKCR-NH2H-Gly-Val-Arg-Asp-Ala-Tyr-Ile-Ala-Asp-Asp-Lys-Asn-Cys-Val-Tyr- Thr-Cys-Ala-Ser-Asn-Gly-Tyr-Cys-Asn-Thr-Glu-Cys-Thr-Lys-Asn-Gly-Ala-Gl u-Ser-Gly-Tyr-Cys-Gln-Trp-Ile-Gly-Arg-Tyr-Gly-Asn-A
Marca:Biosynth
Descrição:OD1 toxin is a peptide that belongs to the scorpion family. It is a potent activator of voltage-gated sodium channels and has been shown to be effective in the treatment of pain, inflammation, and other neurological disorders. OD1 toxin also has the ability to regulate the release of neurotransmitters in the central nervous system. The peptides are produced by Odonthobuthus doriae and are structurally rich in disulfide bonds. These molecules have been shown to act as channel activators, which bind to voltage-gated sodium channels at depolarized membrane potentials, increasing neuronal excitability and triggering action potentials.
Aviso:Os nossos productos estão destinados exclusivamente para uso em laboratório. Para qualquer outra aplicação, por favor entre em contacto.
Propriedades químicas
Peso molecular:7,206.21 g/mol
Fórmula:C308H466N90O95S8
Pureza:Min. 95%
Consulta técnica sobre OD1 Toxin
Por favor, utilize o carrinho para solicitar um orçamento ou uma encomenda
Por favor, utilize o carrinho para solicitar um orçamento ou uma encomenda. Se desejar solicitar um orçamento ou fazer uma encomenda, por favor, adicione os produtos ao seu carrinho e depois solicite um orçamento ou encomenda a partir do carrinho. É mais rápido, mais barato e poderá beneficiar-se dos descontos e outras vantagens disponíveis.