β-Defensin-3 (Human)

Ref. 3D-PDF-4382-S

Informação sobre produto

• Nome: β-Defensin-3 (Human)
• Sinónimos: hBD-3 Gly-Ile-Ile-Asn-Thr-Leu-Gln-Lys-Tyr-Tyr-Cys-Arg-Val-Arg-Gly-Gly- Arg-Cys-Ala-Val-Leu-Ser-Cys-Leu-Pro-Lys-Glu-Glu-Gln-Ile-Gly- Lys-Cys-Ser-Thr-Arg-Gly-Arg-Lys-Cys-Cys-Arg-Arg-Lys-Lys beta-Defensin-3 DEFB3 GIINTLQKYYCRVRGGRCAVLSCLPKEEQIGKCSTRGRKC

Descrição

β-Defensin-3 is a human peptide that belongs to the class of defensins. β-Defensin-3 is a potent activator of ion channels, and has been shown to be an inhibitor of ligand binding. β-Defensin-3 is also known to have antibacterial activity against Gram-positive bacteria such as Staphylococcus aureus. This protein interacts with receptors, such as TNF receptor 1, and can be used as a research tool for studying protein interactions. β-Defensin 3 has been shown to inhibit the growth of tumor cells in vitro by interacting with the intracellular proteins, phosphatidylserine (PS) and annexin A2, which are involved in apoptosis.

• Marca: Biosynth

Propriedades químicas

• Peso molecular: 5,155.1 g/mol
• Fórmula: C₂₁₆H₃₇₁N₇₅O₅₉S₆
• Pureza: Min. 95%