Big Endothelin-3 (Human, 1-41 Amide) Acetate

CAS: 133551-97-0

Ref. 3D-PED-3739-PI

Informação sobre produto

• Nome: Big Endothelin-3 (Human, 1-41 Amide) Acetate
• Sinónimos: H-CTCFTYKDKECVYYCHLDIIWINTPEQTVPYGLSNYRGSFR-NH2

Descrição

Big Endothelin-3 (Human, 1-41 Amide) is a precursor molecule of the Endothelin-3 (ET-3) peptide, that belongs to the large family of endothelin peptides which activate the G-protein coupled receptors ETA and ETB. However ET-3 has lower affinity for the ETA receptors compared to Endothelin-1 (ET-1) and Endothelin-2 (ET-2), whereas all three endothelins have similar affinity for ETB receptors. As ETB receptors make up around 90% of the endothelin receptors found in the cerebral cortex in humans, ET-3 can be nicknamed the ‘brain endothelin’. Also through ET-3’s activation of ETB receptors, ET-3 is involved in the development of the enteric nervous system which controls within the gut, blood flow, secretion and intestinal motility. This product has disulfide bonds between Cys1-Cys15 and Cys3-Cys11.

• Marca: Biosynth

Propriedades químicas

• Peso molecular: 4,923.65 g/mol
• Fórmula: C₂₂₃H₃₂₂N₅₆O₆₃S₄
• Pureza: Min. 95%