H-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGL^M^VGGV^V^IA-OH
Ref. 3D-PP40151
Tamanho indefinido | A consultar |
Informação sobre produto
- NH2-Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile- Gly-Leu^Met^Val-Gly-Gly-Val^Val^Ile-Ala-OH
Peptide H-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGL^M^VGGV^V^IA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGL^M^VGGV^V^IA-OH include the following: Effect of GNP functionalisation and multiple N -methylation of beta -amyloid residue (32-37) on Gram-positive bacterium NM Hemmaragala , H Abrahamse - IET , 2017 - Wiley Online Libraryhttps://ietresearch.onlinelibrary.wiley.com/doi/abs/10.1049/iet-nbt.2016.0083
Propriedades químicas
Consulta técnica sobre: 3D-PP40151 H-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGL^M^VGGV^V^IA-OH
Se desejar solicitar um orçamento ou fazer uma encomenda, por favor, adicione os produtos ao seu carrinho e depois solicite um orçamento ou encomenda a partir do carrinho. É mais rápido, mais barato e poderá beneficiar-se dos descontos e outras vantagens disponíveis.