H-VGGASSLENTVDLHISNSHPLSLTSDQYK^-OH
Ref. 3D-PP41603
| Tamanho indefinido | A consultar |
Informação sobre produto
Peptide H-VGGASSLENTVDLHISNSHPLSLTSDQYK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-VGGASSLENTVDLHISNSHPLSLTSDQYK^-OH include the following: Systematic characterization by mass spectrometric analysis of phosphorylation sites in IRF-3 regulatory domain activated by IKK-i K Fujii, S Nakamura, K Takahashi, F Inagaki - Journal of proteomics, 2010 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S1874391910000461 Identification of a novel in vivo virus-targeted phosphorylation site in interferon regulatory factor-3 (IRF3) B Bergstroem , IB Johnsen, TT Nguyen, L Hagen - Journal of biological , 2010 - ASBMBhttps://www.jbc.org/article/S0021-9258(20)66357-8/abstract
Propriedades químicas
Consulta técnica sobre: 3D-PP41603 H-VGGASSLENTVDLHISNSHPLSLTSDQYK^-OH
Se desejar solicitar um orçamento ou fazer uma encomenda, por favor, adicione os produtos ao seu carrinho e depois solicite um orçamento ou encomenda a partir do carrinho. É mais rápido, mais barato e poderá beneficiar-se dos descontos e outras vantagens disponíveis.
