H-EAEEFFELISKAQSNRADDQRGLLRKEDLVLPEFLR-NH2
Ref. 3D-PP46273
| Tamanho indefinido | A consultar |
Informação sobre produto
- NH2-Glu-Ala-Glu-Glu-Phe-Phe-Glu-Leu-Ile-Ser-Lys-Ala-Gln-Ser-Asn-Arg-Ala-Asp-Asp-Gln-Arg-Gly-Leu-Leu-Arg-Lys-Glu-Asp-Leu-Val-Leu-Pro- Glu-Phe-Leu-Arg-amide
Peptide H-EAEEFFELISKAQSNRADDQRGLLRKEDLVLPEFLR-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-EAEEFFELISKAQSNRADDQRGLLRKEDLVLPEFLR-NH2 include the following: Purification and in vitro functional analyses of RGS12 and RGS14 GoLoco motif peptides RJ Kimple , FS Willard , DP Siderovski - Methods in enzymology, 2004 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0076687904900262
Propriedades químicas
Consulta técnica sobre: 3D-PP46273 H-EAEEFFELISKAQSNRADDQRGLLRKEDLVLPEFLR-NH2
Se desejar solicitar um orçamento ou fazer uma encomenda, por favor, adicione os produtos ao seu carrinho e depois solicite um orçamento ou encomenda a partir do carrinho. É mais rápido, mais barato e poderá beneficiar-se dos descontos e outras vantagens disponíveis.
