H-YSSDPTGALTEDSIDDTFLPVPEYINQSVPK^-OH
Ref. 3D-PP47267
Tamanho indefinido | A consultar |
Informação sobre produto
Peptide H-YSSDPTGALTEDSIDDTFLPVPEYINQSVPK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-YSSDPTGALTEDSIDDTFLPVPEYINQSVPK^-OH include the following: EGFR S1166 phosphorylation induced by a combination of EGF and gefitinib has a potentially negative impact on lung cancer cell growth BF Assiddiq, KY Tan, W Toy, SP Chan - Journal of proteome , 2012 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/pr3002029
Propriedades químicas
Consulta técnica sobre: 3D-PP47267 H-YSSDPTGALTEDSIDDTFLPVPEYINQSVPK^-OH
Se desejar solicitar um orçamento ou fazer uma encomenda, por favor, adicione os produtos ao seu carrinho e depois solicite um orçamento ou encomenda a partir do carrinho. É mais rápido, mais barato e poderá beneficiar-se dos descontos e outras vantagens disponíveis.