H-CGRYLTQETNKVETYKEQPLKTPGKKKKGKPGKRKEQEKKKRRTR-NH2
Ref. 3D-PP49768
| Tamanho indefinido | A consultar |
Informação sobre produto
Peptide H-CGRYLTQETNKVETYKEQPLKTPGKKKKGKPGKRKEQEKKKRRTR-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-CGRYLTQETNKVETYKEQPLKTPGKKKKGKPGKRKEQEKKKRRTR-NH2 include the following: Lipid nanoparticles produce chimeric antigen receptor T cells with interleukin-6 knockdown in vivo J Zhou, L Sun , Y Jia, Z Wang, T Luo, J Tan - Journal of Controlled , 2022 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0168365922005387
Propriedades químicas
Consulta técnica sobre: 3D-PP49768 H-CGRYLTQETNKVETYKEQPLKTPGKKKKGKPGKRKEQEKKKRRTR-NH2
Se desejar solicitar um orçamento ou fazer uma encomenda, por favor, adicione os produtos ao seu carrinho e depois solicite um orçamento ou encomenda a partir do carrinho. É mais rápido, mais barato e poderá beneficiar-se dos descontos e outras vantagens disponíveis.
