Mouse Beta-Defensin 3 peptide
Ref. 3D-PP51064
| 100µg | 533,00 € |
Informação sobre produto
- H-KKINNPVSCLRKGGRCWNRCIGNTRQIGSCGVPFLKCCKRK-OH
mouse Beta-Defensin 3 peptide (mBD3), a homolog of human beta-defensin 2 (hBD2), is a cysteine-rich cationic antimicrobial peptide of 41 amino acids which belongs to the defensins family.
Defensin peptides are cationic peptides originally produced in various organs. They are involved in the protection against different kinds of pathogens like bacteria, fungi, and several viruses and play an important role in inflammation and wound repair.
mBD3 peptide showed antimicrobial activity against Gram-negative bacteria S.Aureus and S.pyogenes and against Gram-positive bacteria like certain strains of P.Aeruginosa (MIC of 8 µg/mL) and E.coli (MIC of 16 µg/mL). Antimicrobial activity has also been demonstrated against C.Albicans.
The in vivo and in vitro efficiency of mBD3 against viruses like influenza was also shown. mBD3 can be interesting for therapeutic use.
Propriedades químicas
Consulta técnica sobre: 3D-PP51064 Mouse Beta-Defensin 3 peptide
Se desejar solicitar um orçamento ou fazer uma encomenda, por favor, adicione os produtos ao seu carrinho e depois solicite um orçamento ou encomenda a partir do carrinho. É mais rápido, mais barato e poderá beneficiar-se dos descontos e outras vantagens disponíveis.
