Informação sobre produto
- H-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGG
H2N-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA-OH is a catalog research peptide that is held in stock. This peptide is provided at >95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer the product in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H2N-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA-OH at the technical inquiry form on this page"