Biochemicals and Reagents
Biochemicals and reagents are fundamental substances for research and development in fields such as biotechnology, molecular biology, pharmacology, and medicine. These products are essential for a variety of applications, including compound synthesis, biological sample analysis, metabolic process research, and drug production. At CymitQuimica, we offer a wide selection of high-quality, high-purity biochemicals and reagents suitable for various scientific and industrial needs. Our catalog includes enzymes, antibodies, nucleic acids, amino acids, and many other products, all designed to support researchers and professionals in their research and development projects, ensuring reliable and reproducible results.
Read more
Subcategories of "Biochemicals and Reagents"
Products of "Biochemicals and Reagents"
H-ALAAELNQLR-OH
Peptide H-ALAAELNQLR-OH is a Research Peptide with significant interest within the field academic and medical …
Ref: 3D-PP49300
| 1mg | 232.00 € | ||
| 10mg | 273.00 € | ||
| 100mg | 497.00 € |
Estimated delivery in United States, on Friday 27 Dec 2024
H-LLIYAVLPTGDVIGDSAK-OH
Peptide H-LLIYAVLPTGDVIGDSAK-OH is a Research Peptide with significant interest within the field academic and medical …
Ref: 3D-PP45865
| 1mg | 356.00 € | ||
| 10mg | 402.00 € | ||
| 100mg | 744.00 € |
Estimated delivery in United States, on Friday 27 Dec 2024
H-NPH-OH
Peptide H-NPH-OH is a Research Peptide with significant interest within the field academic and medical …
Ref: 3D-PP45867
| 1mg | 172.00 € | ||
| 10mg | 196.00 € | ||
| 100mg | 303.00 € |
Estimated delivery in United States, on Friday 27 Dec 2024
H-VHISSVR-OH
Peptide H-VHISSVR-OH is a Research Peptide with significant interest within the field academic and medical …
Ref: 3D-PP48284
| 1mg | 186.00 € | ||
| 10mg | 214.00 € | ||
| 100mg | 369.00 € |
Estimated delivery in United States, on Friday 27 Dec 2024
H-CSKTKERRNRMEVDK-OH
Peptide H-CSKTKERRNRMEVDK-OH is a Research Peptide with significant interest within the field academic and medical …
Ref: 3D-PP45868
| 1mg | 310.00 € | ||
| 10mg | 348.00 € | ||
| 100mg | 631.00 € |
Estimated delivery in United States, on Friday 27 Dec 2024
NVP-TAE684
CAS:761439-42-3
Inhibitor of NPM-ALK kinase
Formula:
C30H40ClN7O3S
Purity:
Min. 95%
Molecular weight:
614.2 g/mol
Ref: 3D-FN65109
| 10mg | 271.00 € | ||
| 50mg | 633.00 € |
Estimated delivery in United States, on Friday 27 Dec 2024
H-LADVYQAELR-OH
Peptide H-LADVYQAELR-OH is a Research Peptide with significant interest within the field academic and medical …
Ref: 3D-PP49301
| 1mg | 232.00 € | ||
| 10mg | 273.00 € | ||
| 100mg | 497.00 € |
Estimated delivery in United States, on Friday 27 Dec 2024
H-FTLIELLIVVAIIGILAAIAIPQFSAYRVKAYNSAASSDLRNLKTALESAFADDQTYPPES-OH
Peptide H-FTLIELLIVVAIIGILAAIAIPQFSAYRVKAYNSAASSDLRNLKTALESAFADDQTYPPES-OH is a Research Peptide with significant interest within the field academic and medical …
Ref: 3D-PP49310
| 1mg | 861.00 € | ||
| 10mg | 1,005.00 € | ||
| 100mg | 2,253.00 € |
Estimated delivery in United States, on Friday 27 Dec 2024
H-AIIRILQQL-OH
Peptide H-AIIRILQQL-OH is a Research Peptide with significant interest within the field academic and medical …
Ref: 3D-PP45870
| 1mg | 217.00 € | ||
| 10mg | 253.00 € | ||
| 100mg | 455.00 € |
Estimated delivery in United States, on Friday 27 Dec 2024
H-RPEDQELESLSAIEAELEK-OH
Peptide H-RPEDQELESLSAIEAELEK-OH is a Research Peptide with significant interest within the field academic and medical …
Ref: 3D-PP49311
| 1mg | 349.00 € | ||
| 10mg | 421.00 € | ||
| 100mg | 746.00 € |
Estimated delivery in United States, on Friday 27 Dec 2024
H-ATYPLPIRGGGC-OH
Peptide H-ATYPLPIRGGGC-OH is a Research Peptide with significant interest within the field academic and medical …
Ref: 3D-PP45871
| 1mg | 263.00 € | ||
| 10mg | 312.00 € | ||
| 100mg | 518.00 € |
Estimated delivery in United States, on Friday 27 Dec 2024
H-CKKPQITTEPHAT-OH
Peptide H-CKKPQITTEPHAT-OH is a Research Peptide with significant interest within the field academic and medical …
Ref: 3D-PP45872
| 1mg | 279.00 € | ||
| 10mg | 331.00 € | ||
| 100mg | 556.00 € |
Estimated delivery in United States, on Friday 27 Dec 2024
H-KKKKK-OH
Peptide H-KKKKK-OH is a Research Peptide with significant interest within the field academic and medical …
Ref: 3D-PP49320
| 1mg | 172.00 € | ||
| 10mg | 194.00 € | ||
| 100mg | 303.00 € |
Estimated delivery in United States, on Friday 27 Dec 2024
H-KALARQLGVAA-OH
Peptide H-KALARQLGVAA-OH is a Research Peptide with significant interest within the field academic and medical …
Ref: 3D-PP45874
| 1mg | 248.00 € | ||
| 10mg | 292.00 € | ||
| 100mg | 481.00 € |
Estimated delivery in United States, on Friday 27 Dec 2024
Neostigmine bromide
CAS:114-80-7
Inhibitor of acetylcholinesterase
Formula:
C12H19BrN2O2
Purity:
Min. 95%
Molecular weight:
303.2 g/mol
Ref: 3D-FN26183
| 2g | 136.00 € | ||
| 5g | 217.00 € | ||
| 10g | 356.00 € | ||
| 25g | 595.00 € | ||
| 50g | 925.00 € |
Estimated delivery in United States, on Friday 27 Dec 2024
H-SACDVSVRV-OH
Peptide H-SACDVSVRV-OH is a Research Peptide with significant interest within the field academic and medical …
Ref: 3D-PP48288
| 1mg | 217.00 € | ||
| 10mg | 253.00 € | ||
| 100mg | 455.00 € |
Estimated delivery in United States, on Friday 27 Dec 2024
H-TTHYGSLPQK-OH
Peptide H-TTHYGSLPQK-OH is a Research Peptide with significant interest within the field academic and medical …
Ref: 3D-PP45875
| 1mg | 232.00 € | ||
| 10mg | 273.00 € | ||
| 100mg | 497.00 € |
Estimated delivery in United States, on Friday 27 Dec 2024
H-LWVYNTQGYF-OH
Peptide H-LWVYNTQGYF-OH is a Research Peptide with significant interest within the field academic and medical …
Ref: 3D-PP45876
| 1mg | 232.00 € | ||
| 10mg | 273.00 € | ||
| 100mg | 497.00 € |
Estimated delivery in United States, on Friday 27 Dec 2024
H-RRKRR-OH
Peptide H-RRKRR-OH is a Research Peptide with significant interest within the field academic and medical …
Ref: 3D-PP49321
| 1mg | 172.00 € | ||
| 10mg | 194.00 € | ||
| 100mg | 303.00 € |
Estimated delivery in United States, on Friday 27 Dec 2024
H-MTSAIGILPV-OH
Peptide H-MTSAIGILPV-OH is a Research Peptide with significant interest within the field academic and medical …
Ref: 3D-PP48291
| 1mg | 232.00 € | ||
| 10mg | 273.00 € | ||
| 100mg | 497.00 € |
Estimated delivery in United States, on Friday 27 Dec 2024
