Product correctly added to cart.

Biochemicals and Reagents
Biochemicals and Reagents

Biochemicals and Reagents

Biochemicals and reagents are fundamental substances for research and development in fields such as biotechnology, molecular biology, pharmacology, and medicine. These products are essential for a variety of applications, including compound synthesis, biological sample analysis, metabolic process research, and drug production. At CymitQuimica, we offer a wide selection of high-quality, high-purity biochemicals and reagents suitable for various scientific and industrial needs. Our catalog includes enzymes, antibodies, nucleic acids, amino acids, and many other products, all designed to support researchers and professionals in their research and development projects, ensuring reliable and reproducible results.

Read more

Products of "Biochemicals and Reagents"

Sort by


See more categories

This search does not contain any category.

products per page. 178194 products on this category.

BrandProduct dataPurityPrice rangeEstimated delivery
Biosynth logo
VIP-Lys(Biotin), human, porcine, rat
REF: 3D-VAC-00484
- - -345.00 €~1,376.00 €Tue 03 Dec 24
Biosynth logo
HIV-gp41-Antigenic Peptide 5
REF: 3D-VAC-00698
- - -469.00 €~1,869.00 €Tue 03 Dec 24
Biosynth logo
H-MFAMKTKAALAIWCPGYSETQINATQAMKKRRKRKVTTNKCLEQVSQLQGLWRRFNRPLLKQQ-OH
REF: 3D-PP47266
- - -To inquireTue 03 Dec 24
Biosynth logo
β-Amyloid (10-20)
REF: 3D-VAC-00864
- - -312.00 €~828.00 €Tue 03 Dec 24
Biosynth logo
[Tyr27]-pTH (27-48) (human)
REF: 3D-VAC-00893
- - -212.00 €~842.00 €Tue 03 Dec 24
Biosynth logo
Tyr-Leptin (26-39) (human)
REF: 3D-FT109022
CAS: 309247-25-4
Min. 95%286.00 €~2,249.00 €Tue 03 Dec 24
Biosynth logo
Cys-Gly-Lys-Lys-Gly-Amyloid β-Protein (37-42)
REF: 3D-VAC-00271
- - -312.00 €~828.00 €Tue 03 Dec 24
Biosynth logo
Peptide Lv (rat) trifluoroacetate salt
REF: 3D-FP110070
CAS: 1872441-58-1
Min. 95%7,735.00 €Tue 03 Dec 24
Biosynth logo
Fluorescein-6-carbonyl-Leu-Glu(OMe)-His-DL-Asp(OMe)-fluoromethylketone
REF: 3D-FF111105
CAS: 1926163-67-8
Min. 95%2,854.00 €Tue 03 Dec 24
Biosynth logo
Ser-Ala-SAP-IIB
REF: 3D-VAC-00702
- - -162.00 €~608.00 €Tue 03 Dec 24
Biosynth logo
CC Chemokine Receptor 3 Fragment I, amide
REF: 3D-VAC-00612
- - -371.00 €~1,480.00 €Tue 03 Dec 24
Biosynth logo
Panitumumab - buffer solution
REF: 3D-FP30153
CAS: 339177-26-3
Min. 95 Area-%482.00 €~2,639.00 €Tue 03 Dec 24
Biosynth logo
C. difficile Toxin B (529-536)
REF: 3D-VAC-00249
- - -229.00 €~637.00 €Tue 03 Dec 24
Biosynth logo
GSK3 Peptide Substrate
REF: 3D-VAC-00446
- - -291.00 €~579.00 €Tue 03 Dec 24
Biosynth logo
Fmoc-D-Asp(OtBu)-(Hmb)Gly-OH
REF: 3D-FF111346
CAS: 1926163-00-9
Min. 95%275.00 €~746.00 €Tue 03 Dec 24
Biosynth logo
[Trp11] Neurotensin (8-13)
REF: 3D-VAC-00688
- - -196.00 €~492.00 €Tue 03 Dec 24
Biosynth logo
HJ Inhibitor Peptide 2
REF: 3D-VAC-00559
- - -196.00 €~492.00 €Tue 03 Dec 24
Biosynth logo
Ac-Pro-Leu-Gly-[(S)-2-mercapto-4-methyl-pentanoyl]-Leu-Gly-OEt
REF: 3D-FA110006
CAS: 98992-65-5
Min. 95%1,187.00 €Tue 03 Dec 24
Biosynth logo
SRC Kinase Substrate, amide
REF: 3D-VAC-00685
- - -154.00 €~579.00 €Tue 03 Dec 24
Biosynth logo
Parathyroid Hormone (70-84), human
REF: 3D-VAC-00210
- - -158.00 €~594.00 €Tue 03 Dec 24
discount label

VIP-Lys(Biotin), human, porcine, rat


Ref: 3D-VAC-00484

1mg345.00 €
5mg878.00 €
10mg1,376.00 €
Estimated delivery in United States, on Tuesday 3 Dec 2024
discount label

HIV-gp41-Antigenic Peptide 5


Ref: 3D-VAC-00698

1mg469.00 €
5mg1,122.00 €
10mg1,869.00 €
Estimated delivery in United States, on Tuesday 3 Dec 2024
discount label

H-MFAMKTKAALAIWCPGYSETQINATQAMKKRRKRKVTTNKCLEQVSQLQGLWRRFNRPLLKQQ-OH


Ref: 3D-PP47266

1mgTo inquire
10mgTo inquire
100mgTo inquire
Estimated delivery in United States, on Tuesday 3 Dec 2024
discount label

β-Amyloid (10-20)


Ref: 3D-VAC-00864

5mg312.00 €
10mg488.00 €
25mg828.00 €
Estimated delivery in United States, on Tuesday 3 Dec 2024
discount label

[Tyr27]-pTH (27-48) (human)


Ref: 3D-VAC-00893

1mg212.00 €
5mg530.00 €
10mg842.00 €
Estimated delivery in United States, on Tuesday 3 Dec 2024
discount label

Tyr-Leptin (26-39) (human)


Ref: 3D-FT109022

1mg457.00 €
2mg717.00 €
5mg1,286.00 €
10mg2,249.00 €
500µg286.00 €
Estimated delivery in United States, on Tuesday 3 Dec 2024
discount label

Cys-Gly-Lys-Lys-Gly-Amyloid β-Protein (37-42)


Ref: 3D-VAC-00271

5mg312.00 €
10mg488.00 €
25mg828.00 €
Estimated delivery in United States, on Tuesday 3 Dec 2024
discount label

Peptide Lv (rat) trifluoroacetate salt


Ref: 3D-FP110070

1mg7,735.00 €
Estimated delivery in United States, on Tuesday 3 Dec 2024
discount label

Fluorescein-6-carbonyl-Leu-Glu(OMe)-His-DL-Asp(OMe)-fluoromethylketone


Ref: 3D-FF111105

1mg2,854.00 €
Estimated delivery in United States, on Tuesday 3 Dec 2024
discount label

Ser-Ala-SAP-IIB


Ref: 3D-VAC-00702

1mg162.00 €
5mg410.00 €
10mg608.00 €
Estimated delivery in United States, on Tuesday 3 Dec 2024
discount label

CC Chemokine Receptor 3 Fragment I, amide


Ref: 3D-VAC-00612

1mg371.00 €
5mg944.00 €
10mg1,480.00 €
Estimated delivery in United States, on Tuesday 3 Dec 2024
discount label

Panitumumab - buffer solution


Ref: 3D-FP30153

1mg736.00 €
2mg1,052.00 €
5mg1,979.00 €
10mg2,639.00 €
Estimated delivery in United States, on Tuesday 3 Dec 2024
discount label

C. difficile Toxin B (529-536)


Ref: 3D-VAC-00249

5mg229.00 €
10mg358.00 €
25mg637.00 €
Estimated delivery in United States, on Tuesday 3 Dec 2024
discount label

GSK3 Peptide Substrate


Ref: 3D-VAC-00446

5mg291.00 €
10mg456.00 €
25mg579.00 €
Estimated delivery in United States, on Tuesday 3 Dec 2024
discount label

Fmoc-D-Asp(OtBu)-(Hmb)Gly-OH


Ref: 3D-FF111346

100mg275.00 €
250mg487.00 €
500mg746.00 €
Estimated delivery in United States, on Tuesday 3 Dec 2024
discount label

[Trp11] Neurotensin (8-13)


Ref: 3D-VAC-00688

5mg196.00 €
10mg295.00 €
25mg492.00 €
Estimated delivery in United States, on Tuesday 3 Dec 2024
discount label

HJ Inhibitor Peptide 2


Ref: 3D-VAC-00559

5mg196.00 €
10mg295.00 €
25mg492.00 €
Estimated delivery in United States, on Tuesday 3 Dec 2024
discount label

Ac-Pro-Leu-Gly-[(S)-2-mercapto-4-methyl-pentanoyl]-Leu-Gly-OEt


Ref: 3D-FA110006

25mg1,187.00 €
Estimated delivery in United States, on Tuesday 3 Dec 2024
discount label

SRC Kinase Substrate, amide


Ref: 3D-VAC-00685

1mg154.00 €
5mg391.00 €
10mg579.00 €
Estimated delivery in United States, on Tuesday 3 Dec 2024
discount label

Parathyroid Hormone (70-84), human


Ref: 3D-VAC-00210

1mg158.00 €
5mg400.00 €
10mg594.00 €
Estimated delivery in United States, on Tuesday 3 Dec 2024
Welcome to CymitQuimica!We use cookies to enhance your visit. We do not include advertising.

Please see our Cookies Policy for more details or adjust your preferences in "Settings".