Biochemicals and Reagents
Biochemicals and reagents are fundamental substances for research and development in fields such as biotechnology, molecular biology, pharmacology, and medicine. These products are essential for a variety of applications, including compound synthesis, biological sample analysis, metabolic process research, and drug production. At CymitQuimica, we offer a wide selection of high-quality, high-purity biochemicals and reagents suitable for various scientific and industrial needs. Our catalog includes enzymes, antibodies, nucleic acids, amino acids, and many other products, all designed to support researchers and professionals in their research and development projects, ensuring reliable and reproducible results.
Subcategories of "Biochemicals and Reagents"
Products of "Biochemicals and Reagents"
VIP-Lys(Biotin), human, porcine, rat
Ref: 3D-VAC-00484
1mg | 345.00 € | ||
5mg | 878.00 € | ||
10mg | 1,376.00 € |
HIV-gp41-Antigenic Peptide 5
Ref: 3D-VAC-00698
1mg | 469.00 € | ||
5mg | 1,122.00 € | ||
10mg | 1,869.00 € |
H-MFAMKTKAALAIWCPGYSETQINATQAMKKRRKRKVTTNKCLEQVSQLQGLWRRFNRPLLKQQ-OH
Ref: 3D-PP47266
1mg | To inquire | ||
10mg | To inquire | ||
100mg | To inquire |
β-Amyloid (10-20)
Ref: 3D-VAC-00864
5mg | 312.00 € | ||
10mg | 488.00 € | ||
25mg | 828.00 € |
[Tyr27]-pTH (27-48) (human)
Ref: 3D-VAC-00893
1mg | 212.00 € | ||
5mg | 530.00 € | ||
10mg | 842.00 € |
Tyr-Leptin (26-39) (human)
Ref: 3D-FT109022
1mg | 457.00 € | ||
2mg | 717.00 € | ||
5mg | 1,286.00 € | ||
10mg | 2,249.00 € | ||
500µg | 286.00 € |
Cys-Gly-Lys-Lys-Gly-Amyloid β-Protein (37-42)
Ref: 3D-VAC-00271
5mg | 312.00 € | ||
10mg | 488.00 € | ||
25mg | 828.00 € |
Peptide Lv (rat) trifluoroacetate salt
Ref: 3D-FP110070
1mg | 7,735.00 € |
Fluorescein-6-carbonyl-Leu-Glu(OMe)-His-DL-Asp(OMe)-fluoromethylketone
Ref: 3D-FF111105
1mg | 2,854.00 € |
Ser-Ala-SAP-IIB
Ref: 3D-VAC-00702
1mg | 162.00 € | ||
5mg | 410.00 € | ||
10mg | 608.00 € |
CC Chemokine Receptor 3 Fragment I, amide
Ref: 3D-VAC-00612
1mg | 371.00 € | ||
5mg | 944.00 € | ||
10mg | 1,480.00 € |
Panitumumab - buffer solution
Ref: 3D-FP30153
1mg | 736.00 € | ||
2mg | 1,052.00 € | ||
5mg | 1,979.00 € | ||
10mg | 2,639.00 € |
C. difficile Toxin B (529-536)
Ref: 3D-VAC-00249
5mg | 229.00 € | ||
10mg | 358.00 € | ||
25mg | 637.00 € |
GSK3 Peptide Substrate
Ref: 3D-VAC-00446
5mg | 291.00 € | ||
10mg | 456.00 € | ||
25mg | 579.00 € |
Fmoc-D-Asp(OtBu)-(Hmb)Gly-OH
Ref: 3D-FF111346
100mg | 275.00 € | ||
250mg | 487.00 € | ||
500mg | 746.00 € |
[Trp11] Neurotensin (8-13)
Ref: 3D-VAC-00688
5mg | 196.00 € | ||
10mg | 295.00 € | ||
25mg | 492.00 € |
HJ Inhibitor Peptide 2
Ref: 3D-VAC-00559
5mg | 196.00 € | ||
10mg | 295.00 € | ||
25mg | 492.00 € |
Ac-Pro-Leu-Gly-[(S)-2-mercapto-4-methyl-pentanoyl]-Leu-Gly-OEt
Ref: 3D-FA110006
25mg | 1,187.00 € |
SRC Kinase Substrate, amide
Ref: 3D-VAC-00685
1mg | 154.00 € | ||
5mg | 391.00 € | ||
10mg | 579.00 € |
Parathyroid Hormone (70-84), human
Ref: 3D-VAC-00210
1mg | 158.00 € | ||
5mg | 400.00 € | ||
10mg | 594.00 € |