Compuestos y reactivos bioquímicos

<p>PLAC1 antibody was raised in rabbit using placenta specific antigen 1 (PLAC1) as the immunogen.</p>

<p>SIV mac251 gp120 antibody was raised in rabbit using purified, full length recombinant gp120 (SIV-1mac251) produced in baculovirus expression system as the immunogen.</p>

<p>ApoB antibody was raised in mouse using human low density lipoprotein as the immunogen.</p>

<p>THC antibody was raised in goat using delta-6-Tetrahydrocannabinol-KLH as the immunogen.</p>

<p>Ferritin antibody was raised in rabbit using human liver ferritin as the immunogen.</p>

<p>THC antibody was raised in sheep using tetrahydrocannabinol-KLH as the immunogen.</p>

<p>HIV1-RT antibody was raised in rabbit using full length recombinant RT (HIV-1) as the immunogen.</p>

<p>Streptococcus group A antibody was raised in goat using group A Streptococci as the immunogen.</p>

<p>HIV1 rev antibody was raised in mouse using full length recombinant rev (HIV-1) produced in E.coli expression system as the immunogen.</p>

<p>Purified recombinant HIV2 gp105 protein</p>

<p>Rabbit anti-guinea pig IgG (H+L) was raised in rabbit using guinea pig IgG whole molecule as the immunogen.</p>

<p>Progesterone 11 antibody was raised in rabbit using Progesterone-11-HSA as the immunogen.</p>

<p>Primidone antibody was raised in goat using primidoen-KLH as the immunogen.</p>

<p>HIV1 tat antibody (FITC) was raised in mouse using purified, full length Recombinant tat (HIV-1) produced in E.coli expression system as the immunogen.</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>Rabbit Polyclonal HIV1 protease antibody</p>

<p>HIV1 gp120 antibody was raised in rabbit using full length recombinant gp120 (HIV-1) as the immunogen.</p>

<p>CD4 antibody was raised in mouse using full length CD4 (T cell receptor) produced in baculovirus expression system as the immunogen.</p>

<p>Purified recombinant HIV1 protease IIIB (HRP)</p>

<p>Mouse monoclonal HIV1 rev antibody (HRP)</p>

<p>HIV1 p24 antibody was raised in goat using p24 (HIV-1 IIIB) as the immunogen.</p>

<p>The Ebola Virus antibody is a powerful tool in the field of Life Sciences. This monoclonal antibody is specifically designed to target and neutralize the glycoprotein of the Ebola virus. It has been extensively tested and proven to be highly effective in detecting and binding to the virus, making it an essential component in research and diagnostics related to Ebola.</p>

<p>Progesterone 3 antibody was raised in rabbit using progesterone 3-CMO-BSA as the immunogen.</p>

<p>The Measles Virus Nucleoprotein antibody is a monoclonal antibody that specifically targets the α-syn protein. It is widely used in life sciences research, particularly in studies related to polymerase chain reactions and cytotoxicity assays. This antibody has been shown to have high affinity and specificity for the α-syn protein, making it an ideal tool for detecting and quantifying this protein in various biological samples.</p>

<p>Vitamin B12 antibody was raised in rabbit using Vitamin B12-BSA as the immunogen.</p>

<p>Mouse monoclonal HIV1 gp41 antibody (HRP)</p>

<p>The CMV antibody is a monoclonal antibody that targets the endothelial growth factor in the body. It is used in life sciences research to study the role of this growth factor in various biological processes. The CMV antibody specifically binds to the nuclear component of the endothelial growth factor and blocks its activity. This antibody has been widely used in studies related to insulin resistance, autoantibodies, and anti-HER2 therapy. Additionally, it has shown potential as a therapeutic agent for inhibiting tumor growth by targeting the epidermal growth factor pathway. The CMV antibody is a valuable tool for researchers studying the mechanisms of cell proliferation and differentiation in different tissues and diseases.</p>

<p>Luteinizing hormone antibody was raised in rabbit using LH beta-KLH as the immunogen.</p>

<p>Rabbit polyclonal HIV1 IIIB protease antibody (FITC)</p>

<p>Nortestosterone antibody was raised in rabbit using 19-nortestosterone-17-KLH as the immunogen.</p>

<p>ELISA kit for the detection of beta 2 Glycoprotein I IgG/IgM in the research laboratory</p>

<p>Goat anti-rat IgG was raised in goat using highly pure rat IgG as the immunogen.</p>

<p>ELISA kit for the detection of dsDNA IgG in the research laboratory</p>

<p>Rabbit polyclonal SIV gp 120 antibody (biotin); full SIV1 mac251 gp120 immunogen</p>

<p>Purified recombinant HIV1 tat HxB2 (biotin)</p>

<p>Purified recombinant HIV1 tat HxB2 (FITC)</p>

<p>Purified recombinant HIV1 p17 IIIB (FITC)</p>

<p>Rabbit anti Sheep IgG was raised in rabbit using affinity pure Sheep IgG as the immunogen.</p>

<p>Cortisol ELISA Kit</p>

<p>Rabbit polyclonal anti-tat HIV1 antibody (FITC)</p>

<p>Anti-Human VISTA Monoclonal Antibody</p>

<p>TAPI-2 is an inhibitor of ADAM-17 (also called TACE) and matrix metalloproteinases (MMPs). It acts as a broad-spectrum inhibitor of these enzymes. TAPI-2 prevents the shedding of tumor necrosis factor-alpha (TNF-α) from cell membranes and can sensitize cancer stem cells to the effects of chemotherapy such as 5-fluorouracil (5-FU) in vitro. It also blocks the phorbol ester-induced shedding of other cell surface proteins like TGF-α and β-amyloid precursor protein.</p>

<p>Peptide H-KLQVFLIVL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-RINSAKDDAAGLQIA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Prostaglandin A1 is a bioactive lipid, which is derived from arachidonic acid through enzymatic pathways. It functions as a signaling molecule with various biological activities, influencing vascular tone, inflammation, and smooth muscle activity. Prostaglandins are a subset of eicosanoids, which are synthesized from essential fatty acids found within phospholipid membranes of cells.</p>

<p>Peptide H-TEFTTALQR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-VYIHPF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-WHWLQLKPGQPMY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-WHWLQLKPGQPMY-OH include the following: Position one analogs of the Saccharomyces cerevisiae tridecapeptide pheromone YL Zhang, HUIFEN LU, JM Becker - The Journal of peptide , 1997 - Wiley Online Library<a href="https://onlinelibrary.wiley.com/doi/abs/10.1111/j.1399-3011.1997.tb01190.x" target="_blank" rel="noreferrer noopener">https://onlinelibrary.wiley.com/doi/abs/10.1111/j.1399-3011.1997.tb01190.x</a> Synthesis, Biological Activity, and Conformational Analysis of Peptidomimetic Analogues of the Saccharomyces cerevisiae alpha-Factor Tridecapeptide YL Zhang, HR Marepalli, H Lu, JM Becker - Biochemistry, 1998 - ACS Publications<a href="https://pubs.acs.org/doi/abs/10.1021/bi980787u" target="_blank" rel="noreferrer noopener">https://pubs.acs.org/doi/abs/10.1021/bi980787u</a> Receptor in Saccharomyces cereuisiae SK RathsSQ, M BeckerSII - researchgate.net<a href="https://www.researchgate.net/profile/Jeffrey-Becker-2/publication/20308809_Peptide_analogs_compete_with_binding_of_-factor_to_its_receptor_in_Saccharomyces_cerevisiae/links/09e415111549c85414000000/Peptide-analogs-compete-with-binding-of-factor-to-its-receptor-in-Saccharomyces-cerevisiae.pdf" target="_blank" rel="noreferrer noopener">https://www.researchgate.net/profile/Jeffrey-Becker-2/publication/20308809_Peptide_analogs_compete_with_binding_of_-factor_to_its_receptor_in_Saccharomyces_cerevisiae/links/09e415111549c85414000000/Peptide-analogs-compete-with-binding-of-factor-to-its-receptor-in-Saccharomyces-cerevisiae.pdf</a> Peptide analogues compete with the binding of alpha-factor to its receptor in Saccharomyces cerevisiae. SK Raths, F Naider, JM Becker - Journal of Biological Chemistry, 1988 - Elsevier<a href="https://www.sciencedirect.com/science/article/pii/S0021925819778405" target="_blank" rel="noreferrer noopener">https://www.sciencedirect.com/science/article/pii/S0021925819778405</a> Binding of fluorinated phenylalanine alpha-factor analogues to ste2p: Evidence for a cation-Ï€ binding interaction between a peptide ligand and its cognate G protein S Tantry, FX Ding, M Dumont , JM Becker, F Naider - Biochemistry, 2010 - ACS Publications<a href="https://pubs.acs.org/doi/abs/10.1021/bi100280f" target="_blank" rel="noreferrer noopener">https://pubs.acs.org/doi/abs/10.1021/bi100280f</a> Position 13 analogs of the tridecapeptide mating pheromone from Saccharomyces cerevisiae: design of an iodinatable ligand for receptor binding S Liu, B Arshava, F Naider, LK Henry - Journal of Peptide , 2000 - Wiley Online Library<a href="https://onlinelibrary.wiley.com/doi/abs/10.1034/j.1399-3011.2000.00730.x" target="_blank" rel="noreferrer noopener">https://onlinelibrary.wiley.com/doi/abs/10.1034/j.1399-3011.2000.00730.x</a> Ab initio calculations on Pro-Ala and Pro-Gly dipeptides O Antohi, F Naider, AM Sapse - Journal of Molecular Structure , 1996 - Elsevier<a href="https://www.sciencedirect.com/science/article/pii/0166128095043608" target="_blank" rel="noreferrer noopener">https://www.sciencedirect.com/science/article/pii/0166128095043608</a> Structural requirement tryptophan1,3 of tridecapeptide mating pheromone of Saccharomyces cerevisiae NJ Hong, YA Park, JW Lee - : Proceedings of the 1st International Peptide , 2002 - Springer<a href="https://link.springer.com/content/pdf/10.1007/0-306-46864-6_157.pdf" target="_blank" rel="noreferrer noopener">https://link.springer.com/content/pdf/10.1007/0-306-46864-6_157.pdf</a> Studies on conformational consequences of i to i+ 3 side-chain cyclization in model cyclic tetrapeptides MH RAO, WEI YANG, H JOSHUA - Journal of Peptide , 1995 - Wiley Online Library<a href="https://onlinelibrary.wiley.com/doi/abs/10.1111/j.1399-3011.1995.tb01057.x" target="_blank" rel="noreferrer noopener">https://onlinelibrary.wiley.com/doi/abs/10.1111/j.1399-3011.1995.tb01057.x</a> Specificity characterization of the alpha-mating factor hormone by Kex2 protease MA Manfredi, AA Antunes, LOP Jesus, MA Juliano - Biochimie, 2016 - Elsevier<a href="https://www.sciencedirect.com/science/article/pii/S0300908416302358" target="_blank" rel="noreferrer noopener">https://www.sciencedirect.com/science/article/pii/S0300908416302358</a> Control of the yeast cell cycle with a photocleavable alpha-factor analogue LL Parker , JW Kurutz, SBH Kent - Chemie (International ed , 2006 - ncbi.nlm.nih.gov<a href="https://www.ncbi.nlm.nih.gov/pmc/articles/PMC2788609/" target="_blank" rel="noreferrer noopener">https://www.ncbi.nlm.nih.gov/pmc/articles/PMC2788609/</a> Matrix-assisted laser desorption/ionization mass spectrometry peptide sequencing utilizing selective N-terminal bromoacetylation J Song, HJ Kim - Analytical biochemistry, 2012 - Elsevier<a href="https://www.sciencedirect.com/science/article/pii/S0003269711007548" target="_blank" rel="noreferrer noopener">https://www.sciencedirect.com/science/article/pii/S0003269711007548</a> Solution Structures of i to i + 3 Cyclized Model Peptides: Building Blocks Mimicking Specific Conformations HR Marepalli, O Antohi, JM Becker - Journal of the American , 1996 - ACS Publications<a href="https://pubs.acs.org/doi/abs/10.1021/ja954217i" target="_blank" rel="noreferrer noopener">https://pubs.acs.org/doi/abs/10.1021/ja954217i</a> Highly active analogs of alpha-factor and their activities against Saccharomyces cerevisiae HJ Ahn, EY Hong, DH Jin, NJ Hong - Bulletin of the Korean Chemical , 2014 - Citeseer<a href="https://citeseerx.ist.psu.edu/document?repid=rep1&amp;type=pdf&amp;doi=509ee315e2cbcb9fac108f48dfb1fa89d076f1b2" target="_blank" rel="noreferrer noopener">https://citeseerx.ist.psu.edu/document?repid=rep1&amp;type=pdf&amp;doi=509ee315e2cbcb9fac108f48dfb1fa89d076f1b2</a> Identification of residue-to-residue contact between a peptide ligand and its G protein-coupled receptor using periodate-mediated dihydroxyphenylalanine cross GKE Umanah, L Huang , F Ding, B Arshava - Journal of biological , 2010 - ASBMB<a href="https://www.jbc.org/article/S0021-9258(20)60639-1/abstract" target="_blank" rel="noreferrer noopener">https://www.jbc.org/article/S0021-9258(20)60639-1/abstract</a> Cross-linking of a DOPA-containing peptide ligand into its G protein-coupled receptor GKE Umanah, C Son , FX Ding, F Naider - Biochemistry, 2009 - ACS Publications<a href="https://pubs.acs.org/doi/abs/10.1021/bi802061z" target="_blank" rel="noreferrer noopener">https://pubs.acs.org/doi/abs/10.1021/bi802061z</a> Structural requirements for alpha-mating factor activity G Houen, O Nielsen, C Flanagan - FEBS letters, 1996 - Elsevier<a href="https://www.sciencedirect.com/science/article/pii/0014579396007260" target="_blank" rel="noreferrer noopener">https://www.sciencedirect.com/science/article/pii/0014579396007260</a> The alpha-factor mating pheromone of Saccharomyces cerevisiae: a model for studying the interaction of peptide hormones and G protein-coupled receptors F Naider, JM Becker - Peptides, 2004 - Elsevier<a href="https://www.sciencedirect.com/science/article/pii/S0196978104002943" target="_blank" rel="noreferrer noopener">https://www.sciencedirect.com/science/article/pii/S0196978104002943</a> Studies on the yeast alpha-mating factor: A model for mammalian peptide hormones F Naider, J Gounarides, CB Xue - Biopolymers , 1992 - Wiley Online Library<a href="https://onlinelibrary.wiley.com/doi/abs/10.1002/bip.360320407" target="_blank" rel="noreferrer noopener">https://onlinelibrary.wiley.com/doi/abs/10.1002/bip.360320407</a> Probing the Binding Site of a Heptahelical Peptide Pheromone Receptor Using Photoaffinity Labelling, Site-Directed Mutagenesis and Spectroscopic Approaches F Naider, BK Lee, LK Henry, F Ding, SK Khare - Peptides: The Wave of , 2001 - Springer<a href="https://link.springer.com/chapter/10.1007/978-94-010-0464-0_409" target="_blank" rel="noreferrer noopener">https://link.springer.com/chapter/10.1007/978-94-010-0464-0_409</a> Biophysical studies on a transmembrane peptide of the Saccharomyces cerevisiae alpha-factor receptor F Naider, B Arshava, H Xie, S Liu, WY Eng - Peptides for the New , 2002 - Springer<a href="https://link.springer.com/content/pdf/10.1007/0-306-46881-6_151.pdf" target="_blank" rel="noreferrer noopener">https://link.springer.com/content/pdf/10.1007/0-306-46881-6_151.pdf</a> Characterization of novel peptide agonists of the alpha mating factor of Saccharomyces cerevisiae EG Siegel, R Gunther, H Schafer, UR Fölsch - Analytical , 1999 - Elsevier<a href="https://www.sciencedirect.com/science/article/pii/S0003269799942896" target="_blank" rel="noreferrer noopener">https://www.sciencedirect.com/science/article/pii/S0003269799942896</a> Antagonistic and synergistic peptide analogs of the tridecapeptide mating pheromone of Saccharomyces cerevisiae E Eriotou-Bargiota , CB Xue, F Naider, JM Becker - Biochemistry, 1992 - ACS Publications<a href="https://pubs.acs.org/doi/pdf/10.1021/bi00117a036" target="_blank" rel="noreferrer noopener">https://pubs.acs.org/doi/pdf/10.1021/bi00117a036</a> Probing the functional conformation of the tridecapeptide mating pheromone of Saccharomyces cerevisiae through study of disulfide-constrained analogs CHUB XUE, A MCKINNEY, HUIFEN LU - journal of peptide , 1996 - Wiley Online Library<a href="https://onlinelibrary.wiley.com/doi/abs/10.1111/j.1399-3011.1996.tb01336.x" target="_blank" rel="noreferrer noopener">https://onlinelibrary.wiley.com/doi/abs/10.1111/j.1399-3011.1996.tb01336.x</a> Spiegel, zyxwvutsrqponm B Molitoris, AC Alfrey, RA Harris, FR Simon - Am. J. Physiol, 1985 - academia.edu<a href="https://www.academia.edu/download/41221846/Antagonistic_and_synergistic_peptide_ana20160115-15517-198v4vt.pdf" target="_blank" rel="noreferrer noopener">https://www.academia.edu/download/41221846/Antagonistic_and_synergistic_peptide_ana20160115-15517-198v4vt.pdf</a> Long-distance rotational echo double resonance measurements for the determination of secondary structure and conformational heterogeneity in peptides B Arshava, M Breslav, O Antohi, RE Stark - Solid State Nuclear , 1999 - Elsevier<a href="https://www.sciencedirect.com/science/article/pii/S0926204099000181" target="_blank" rel="noreferrer noopener">https://www.sciencedirect.com/science/article/pii/S0926204099000181</a> Synthesis of biologically active analogs of the dodecapeptide alpha-factor mating pheromone of Saccharomyces cerevisiae A EWENSON, S MARCUS - Journal of Peptide , 1990 - Wiley Online Library<a href="https://onlinelibrary.wiley.com/doi/abs/10.1111/j.1399-3011.1990.tb00944.x" target="_blank" rel="noreferrer noopener">https://onlinelibrary.wiley.com/doi/abs/10.1111/j.1399-3011.1990.tb00944.x</a></p>

<p>Peptide H-WRQAAFVDSY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-VAANIVLTV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-NWAPGEPNNR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-GYGFGLIK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-MRWQEMGYIFYPRKLR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-GPGGAWAAEVISNAR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-GDSLAYGLR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>UM171 is a small-molecule compound, which is derived from synthetic chemical processes with properties that enable the expansion of human hematopoietic stem cells (HSCs) in vitro. It acts by targeting and modulating specific cellular pathways to enhance the self-renewal and proliferation of HSCs without inducing differentiation.<br><br>The primary application of UM171 lies in the field of regenerative medicine and transplantation. By facilitating the expansion of HSCs, UM171 holds significant potential in improving the outcomes of bone marrow and cord blood transplants. This is particularly relevant in contexts where donor cell availability is limited or where augmenting the engraftment potential of HSCs is critical. The ability to expand HSCs ex vivo opens avenues for improved treatment of hematological disorders, potentially allowing for more effective and accessible transplant therapies. Researchers are exploring its utility in diverse experimental setups, aiming to translate this compound's capabilities into clinical settings to enhance patient outcomes in hematopoietic recovery and therapy.</p>

<p>Please enquire for more information about Elafibranor including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Key subunit of extracellular plaques found in the brains of patients with Alzheimer's disease. TFA salt; 95%.</p>

<p>Peptide H-IYQEPFKNLK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-ALVEICTEM-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-DRFYKTLRAEQASQEV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>TAPI-1 is an inhibitor of TACE (TNF-α converting enzyme, also known as ADAM17) and matrix metalloproteinases (MMPs). It blocks the shedding of several cell surface proteins, including tumor necrosis factor-alpha (TNF-α), IL-6 receptor, and TNF receptors p60 (TNFRI) and p80 (TNFRII).</p>

<p>Peptide H-DGRGDS-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-ALNRTSSDSALHRRR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-ALNRTSSDSALHRRR-OH include the following: Enhanced activation of cellular AMPK by dual-small molecule treatment: AICAR and A769662 S Ducommun , RJ Ford, L Bultot - American Journal , 2014 - journals.physiology.org<a href="https://journals.physiology.org/doi/abs/10.1152/ajpendo.00672.2013" target="_blank" rel="noreferrer noopener">https://journals.physiology.org/doi/abs/10.1152/ajpendo.00672.2013</a> Characterization of WZ4003 and HTH-01-015 as selective inhibitors of the LKB1-tumour-suppressor-activated NUAK kinases S Banerjee , SJ Buhrlage, HT Huang , X Deng - Biochemical , 2014 - portlandpress.com<a href="https://portlandpress.com/biochemj/article-abstract/457/1/215/46906" target="_blank" rel="noreferrer noopener">https://portlandpress.com/biochemj/article-abstract/457/1/215/46906</a> Interplay between Polo kinase, LKB1-activated NUAK1 kinase, PP1betaMYPT1 phosphatase complex and the SCFbetaTrCP E3 ubiquitin ligase S Banerjee , A Zagorska, M Deak - Biochemical , 2014 - portlandpress.com<a href="https://portlandpress.com/biochemj/article-abstract/461/2/233/46874" target="_blank" rel="noreferrer noopener">https://portlandpress.com/biochemj/article-abstract/461/2/233/46874</a> Inhibition of SIK2 and SIK3 during differentiation enhances the anti-inflammatory phenotype of macrophages NJ Darling , R Toth, JSC Arthur , K Clark - Biochemical Journal, 2017 - portlandpress.com<a href="https://portlandpress.com/biochemj/article-abstract/474/4/521/49590" target="_blank" rel="noreferrer noopener">https://portlandpress.com/biochemj/article-abstract/474/4/521/49590</a> Comparison of the specificity of Trk inhibitors in recombinant and neuronal assays KJ Martin, N Shpiro, R Traynor, M Elliott , JSC Arthur - Neuropharmacology, 2011 - Elsevier<a href="https://www.sciencedirect.com/science/article/pii/S0028390811001389" target="_blank" rel="noreferrer noopener">https://www.sciencedirect.com/science/article/pii/S0028390811001389</a> Enhanced activation of cellular AMPK by dual small GR Kemp, K Sakamoto - 2014 - journals.physiology.org<a href="https://journals.physiology.org/doi/prev/20140114-aop/epdf/10.1152/ajpendo.00672.2013" target="_blank" rel="noreferrer noopener">https://journals.physiology.org/doi/prev/20140114-aop/epdf/10.1152/ajpendo.00672.2013</a> The AMPK-related kinase SIK2 is regulated by cAMP via phosphorylation at Ser358 in adipocytes E Henriksson, HA Jones, K Patel , M Peggie - Biochemical , 2012 - portlandpress.com<a href="https://portlandpress.com/biochemj/article-abstract/444/3/503/46279" target="_blank" rel="noreferrer noopener">https://portlandpress.com/biochemj/article-abstract/444/3/503/46279</a></p>

<p>Peptide H-NLDTASTTL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-VVSEDFLQDVSASTK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-VIYEQANAHGQ-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>A hydroxamate-based inhibitor of collagenase, gelatinase, and TACE. TACE stands for Tumor Necrosis Factor-α Converting Enzyme. It is also known as ADAM17 (A Disintegrin and Metalloproteinase 17)</p>

<p>H-NKWGNAVIGAATGATRGVSWCRGFGPWGMTACGLGGAAIGGYLGYKSN-OH is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote Tool</p>