Anticuerpos primarios
Subcategorías de "Anticuerpos primarios"
- Anticuerpos para la investigación del cáncer(3.721 productos)
- Anticuerpos cardiovasculares(2 productos)
- Biología del desarrollo(764 productos)
- Anticuerpos Epigenéticos(162 productos)
- Anticuerpos inmunológicos(2.585 productos)
- Anticuerpos del metabolismo(286 productos)
- Anticuerpos de microbiología(741 productos)
- Transducción de señales(2.765 productos)
- Etiquetas y marcadores celulares(34 productos)
Se han encontrado 75594 productos de "Anticuerpos primarios"
MVP antibody
MVP antibody was raised using the N terminal of MVP corresponding to a region with amino acids MATEEFIIRIPPYHYIHVLDQNSNVSRVEVGPKTYIRQDNERVLFAPMRM
WNT2 antibody
The WNT2 antibody is a polyclonal antibody that specifically targets the protein WNT2. This antibody is widely used in Life Sciences research to study the role of WNT2 in various biological processes. WNT2 is an important signaling molecule involved in cell development, proliferation, and differentiation. It plays a crucial role in embryonic development and tissue homeostasis.
ZNF12 antibody
ZNF12 antibody was raised in rabbit using the N terminal of ZNF12 as the immunogen
Pureza:Min. 95%Goat anti Rabbit IgG (H + L) (FITC)
This antibody reacts with heavy (gamma) chains on rabbit IgG and light chains on all rabbit immunoglobulins.
Pureza:Min. 95%GSK3B antibody
The GSK3B antibody is a highly specific and potent monoclonal antibody that targets the fms-like tyrosine kinase 3 beta (GSK3B). It is designed to neutralize the activity of GSK3B, which plays a crucial role in various cellular processes. This antibody has been extensively studied and proven to be effective in inhibiting the function of GSK3B.
Troponin T antibody (Cardiac)
Troponin T antibody (cardiac) was raised in mouse using free human cTnT as the immunogen.
MDMA antibody
The MDMA antibody is a monoclonal antibody that is used in Life Sciences research. It has the ability to specifically bind to MDMA (3,4-methylenedioxymethamphetamine), commonly known as ecstasy. This antibody can be used for various applications, such as detecting MDMA in biological samples or studying its effects on different systems.
Pureza:Min. 95%Goat anti Bovine IgG (FITC)
Goat anti-bovine IgG (FITC) was raised in goat using bovine IgG F(c) fragment as the immunogen.
Pureza:Min. 95%Cdk3 antibody
The Cdk3 antibody is a monoclonal antibody that specifically targets and binds to sclerostin, a protein involved in the regulation of bone metabolism. This antibody has been extensively validated in various assays, including colloidal gold immunolabeling and nuclear staining. It has been widely used in research studies within the Life Sciences field to investigate the role of sclerostin in bone development and diseases such as osteoporosis.
TP53 antibody
TP53 antibody is an inhibitory factor that targets the TP53 gene, which plays a crucial role in regulating cell growth and preventing tumor formation. This antibody specifically binds to the TP53 protein, blocking its activity and inhibiting hepatocyte growth. It can be used in various research applications in Life Sciences, such as Western blotting, immunohistochemistry, and immunofluorescence. The TP53 antibody is available as both a polyclonal antibody and a monoclonal antibody, providing researchers with options based on their specific needs. It has been validated for use in multiple species and has been shown to have high specificity and sensitivity. Additionally, streptavidin conjugates are available for enhanced detection when using biotinylated secondary antibodies. The TP53 antibody is supplied in a convenient format with appropriate storage conditions and contains no unnecessary excipients that could interfere with experimental results. Whether studying the role of TP53 in cancer biology or investigating its interaction with other proteins like c-myc
