Anticuerpos primarios

The CYP2J2 antibody is a highly specialized monoclonal antibody used in Life Sciences research. It is specifically designed to target and detect the CYP2J2 enzyme, which plays a crucial role in the metabolism of drugs and other foreign substances in the body. This antibody is commonly used in studies involving mesenchymal stem cells, reactive oxygen species, and electrode-based assays.

The STAT2 antibody is a highly specialized antibody that plays a crucial role in the interferon signaling pathway. It specifically targets and binds to STAT2, a protein involved in regulating gene expression in response to interferon signals. By binding to STAT2, this antibody effectively inhibits its activity, preventing the downstream effects of interferon signaling.

The Fenitrothion antibody is a monoclonal antibody used in Life Sciences research. It specifically targets and binds to fenitrothion, a commonly used organophosphate insecticide. This antibody can be utilized for various applications, including immunoassays, Western blotting, and immunohistochemistry.

C4orf15 antibody was raised in Rabbit using Human C4orf15 as the immunogen

The GPR18 antibody is a polyclonal antibody used in the field of Life Sciences. It is commonly used in various assays and experiments to study the functions and interactions of GPR18, a glycoprotein receptor. This antibody is highly specific and has been proven effective in detecting GPR18 in different biological samples.

Rabbit anti-cat IgG (H+L) (Rhodamine) was raised in rabbit using feline IgG whole molecule as the immunogen.

FH antibody is a monoclonal antibody used in Life Sciences research. It specifically targets and binds to the growth factor FH, preventing its dephosphorylation and promoting the formation of dimers. This antibody has been shown to inhibit interferon-induced cell death and activate mitogen-activated protein (MAP) kinase signaling pathways. Additionally, FH antibody has been found to modulate arachidonic acid metabolism and enhance the effects of epidermal growth factor (EGF). It can also be used in the detection of atypical hemolytic uremic syndrome (aHUS) and as a tool for studying autoantibodies. FH antibody is part of a range of high-quality monoclonal antibodies designed for various applications in Life Sciences research.

Troponin T antibody (cardiac) was raised in mouse using free human cTnT as the immunogen.

EGFR antibody (AF488) was raised in mouse using human A431 membrane proteins as the immunogen.

Rabbit polyclonal elF4E antibody (Ser209)

Mouse thrombocyte antibody was raised in rabbit using mouse thrombocytes as the immunogen.

STEAP3 antibody was raised using the C terminal of STEAP3 corresponding to a region with amino acids VALVLSTLHTLTYGWTRAFEESRYKFYLPPTFTLTLLVPCVVILAKALFL

The PLVAP antibody is a glycopeptide that belongs to the class of antibodies used in Life Sciences. It is specifically designed to target and bind to PLVAP (Plasmalemma Vesicle-Associated Protein), an important protein involved in various biological processes. This antibody is available in both polyclonal and monoclonal forms, providing researchers with options for their specific experimental needs.

Lipoprotein Lipase Monoclonal Antibody Biotin

Affinity purified Rabbit polyclonal MAP2K3 antibody

Keratin K4 antibody was raised in Guinea Pig using synthetic peptide of human keratin K4 coupled to KLH as the immunogen.