Anticuerpos primarios
Subcategorías de "Anticuerpos primarios"
- Anticuerpos para la investigación del cáncer(3.620 productos)
- Anticuerpos cardiovasculares(2 productos)
- Biología del desarrollo(751 productos)
- Anticuerpos Epigenéticos(162 productos)
- Anticuerpos inmunológicos(2.551 productos)
- Anticuerpos del metabolismo(279 productos)
- Anticuerpos de microbiología(740 productos)
- Transducción de señales(2.717 productos)
- Etiquetas y marcadores celulares(33 productos)
Se han encontrado 75511 productos de "Anticuerpos primarios"
PKR1 antibody
The PKR1 antibody is a highly specialized chemokine that is activated in various Life Sciences applications. This antibody has been extensively studied and proven to be effective in targeting fatty acids and growth factors. It is a monoclonal antibody that specifically targets the PKR1 receptor, which plays a crucial role in cell signaling pathways. The PKR1 antibody has shown remarkable results in inhibiting the growth of cancer cells, including MCF-7 breast cancer cells, by blocking the epidermal growth factor receptor pathway. Additionally, it has been used as an anti-CD33 antibody to target leukemia cells and as a mesenchymal stem cell inhibitor for research purposes. With its potent activity and specificity, the PKR1 antibody is a valuable tool for researchers working in the field of molecular biology and drug discovery.
KLC3 antibody
KLC3 antibody was raised using the middle region of KLC3 corresponding to a region with amino acids MLNILALVYRDQNKYKEATDLLHDALQIREQTLGPEHPAVAATLNNLAVL
SNRP70 antibody
SNRP70 antibody was raised using a synthetic peptide corresponding to a region with amino acids YLPPLEKLPHEKHHNQPYCGIAPYIREFEDPRDAPPPTRAETREERMERK
IQCE antibody
IQCE antibody was raised using the middle region of IQCE corresponding to a region with amino acids KKMGSALLSLSRSVQELTEENQSLKEDLDRVLSTSPTISKTQGYVEWSKP
XAF1 antibody
The XAF1 antibody is a high-quality monoclonal antibody that specifically binds to XAF1 protein, an important regulator of apoptosis. This antibody can be used for the treatment and/or prophylaxis of various diseases, including cancer. The XAF1 antibody has been extensively tested in both in vitro and in vivo studies, demonstrating its efficacy in inducing apoptosis in cancer cells.
Goat anti Human Lambda Chain (biotin)
Goat anti-human lambda chain (biotin) was raised in goat using human l lambda chain as the immunogen.
Pureza:Min. 95%IL4 antibody
The IL4 antibody is a pegylated monoclonal antibody that is used in the field of Life Sciences as a medicament. It has been extensively studied for its glycation properties, particularly in human serum. The IL4 antibody can be immobilized onto a carbon electrode and used in electrochemical detection methods. It has also been used in conjunction with adeno-associated viruses to deliver therapeutic antibodies directly to specific cells or tissues. Additionally, the IL4 antibody has been shown to bind to actin filaments and can be labeled with phalloidin for visualization purposes. With its wide range of applications and specificity, the IL4 antibody is a valuable tool in various research fields.
Spermidine synthase antibody
The Spermidine synthase antibody is a monoclonal antibody that specifically targets the tyrosine residue in interleukin-6 (IL-6). It is a highly specific and sensitive tool used in Life Sciences research to detect and quantify IL-6 levels in various biological samples. This antibody has been extensively validated for its specificity, sensitivity, and reproducibility.
