Anticuerpos primarios
Los anticuerpos primarios son inmunoglobulinas que se unen específicamente a un antígeno de interés, permitiendo la detección y cuantificación de proteínas, péptidos u otras biomoléculas. Estos anticuerpos son herramientas fundamentales en una amplia gama de aplicaciones, como el Western blot, la inmunohistoquímica y el ELISA. En CymitQuimica, ofrecemos una extensa selección de anticuerpos primarios de alta calidad que brindan especificidad y sensibilidad para diversas necesidades de investigación, incluidas las áreas de cáncer, inmunología y biología celular.
Subcategorías de "Anticuerpos primarios"
- Anticuerpos para la investigación del cáncer(3.620 productos)
- Anticuerpos cardiovasculares(2 productos)
- Biología del desarrollo(751 productos)
- Anticuerpos Epigenéticos(162 productos)
- Anticuerpos inmunológicos(2.551 productos)
- Anticuerpos del metabolismo(279 productos)
- Anticuerpos de microbiología(740 productos)
- Transducción de señales(2.717 productos)
- Etiquetas y marcadores celulares(33 productos)
Mostrar 1 subcategorías más
Se han encontrado 75448 productos de "Anticuerpos primarios"
Ordenar por
Pureza (%)
0
100
|
0
|
50
|
90
|
95
|
100
Goat anti Human IgG (Alk Phos)
Goat anti-human IgG (Alk Phos) was raised in goat using human IgG F(c) fragment as the immunogen.
Pureza:Min. 95%Donkey anti Rabbit IgG (H + L) (Fab'2) (FITC)
Donkey anti-rabbit IgG (H + L) (Fab'2) (FITC) was raised in donkey using rabbit IgG (H&L) as the immunogen.Pureza:Min. 95%Rabbit anti Dog IgG (HRP)
Rabbit anti-dog IgG (HRP) was raised in rabbit using canine IgG F(ab')2 fragment as the immunogen.Pureza:Min. 95%CD3e antibody (Spectral Red)
CD3e antibody (Spectral Red) was raised in hamster using H-2Kb-specific murine cytotoxic T lymphocyte as the immunogen.
Pureza:Min. 95%DHEA antibody
The DHEA antibody is a polyclonal antibody that is used for the quantitation and detection of dehydroepiandrosterone (DHEA) in various biological samples. The DHEA antibody was raised in sheep using DHEA(17)-BTG as the immunogen. Supplied at 10mg/ml, a matched pair conjugate is available for DHEA antibody: 80-1055Pureza:Min. 95%ATG5 antibody
ATG5 antibody was raised in rabbit using the middle region of ATG5 as the immunogenPureza:Min. 95%KLK6 antibody
KLK6 antibody was raised using the N terminal of KLK6 corresponding to a region with amino acids KHNLRQRESSQEQSSVVRAVIHPDYDAASHDQDIMLLRLARPAKLSELIQ
Estrogen Receptor alpha antibody
The Estrogen Receptor alpha antibody is a powerful tool in the field of Life Sciences. This antibody specifically targets the estrogen receptor alpha, a protein that plays a crucial role in various cellular processes. The antibody is derived from high-quality sources and has been extensively tested for its specificity and effectiveness.Pureza:Min. 95%Goat anti Rat IgM (Alk Phos)
Goat anti-rat IgM (Alk Phos) was raised in goat using rat IgM mu chain as the immunogen.
Pureza:Min. 95%Lgi2 antibody
Lgi2 antibody was raised in rabbit using the middle region of Lgi2 as the immunogen
Pureza:Min. 95%STAT6 antibody
STAT6 antibody was raised in rabbit using the C terminal of STAT6 as the immunogenPureza:Min. 95%
