Anticuerpos primarios
Subcategorías de "Anticuerpos primarios"
- Anticuerpos para la investigación del cáncer(3.620 productos)
- Anticuerpos cardiovasculares(2 productos)
- Biología del desarrollo(751 productos)
- Anticuerpos Epigenéticos(162 productos)
- Anticuerpos inmunológicos(2.551 productos)
- Anticuerpos del metabolismo(279 productos)
- Anticuerpos de microbiología(740 productos)
- Transducción de señales(2.717 productos)
- Etiquetas y marcadores celulares(33 productos)
Se han encontrado 75448 productos de "Anticuerpos primarios"
Goat anti Rabbit IgG (HRP)
Goat anti-rabbit IgG (HRP) was raised in goat using rabbit IgG F(c) fragment as the immunogen.Pureza:Min. 95%LGR4 antibody
The LGR4 antibody is a highly sensitive detection tool that utilizes electrochemical impedance spectroscopy to detect the presence of specific antibodies. It is designed to provide accurate and reliable results in various life science applications. The electrode used in conjunction with this antibody allows for ultrasensitive detection, making it ideal for research and diagnostic purposes.Tyrosine Hydroxylase antibody
The Tyrosine Hydroxylase antibody is a powerful tool used in Life Sciences research. This monoclonal antibody specifically targets and detects tyrosine hydroxylase, an enzyme involved in the synthesis of dopamine, a neurotransmitter that plays a crucial role in various physiological processes. The Tyrosine Hydroxylase antibody recognizes an epitope located within the protein sequence of tyrosine hydroxylase, allowing for precise and accurate detection.
Donkey anti Goat IgG (H + L)
This antibody reacts with heavy chains on Goat IgG and light chains on all Goat immunoglobulins.Pureza:Min. 95%H2B antibody
The H2B antibody is a polyclonal antibody that has neutralizing properties. It is used in the field of Life Sciences to study various aspects of cellular biology. This antibody specifically targets the interferon-gamma (IFN-gamma) pathway, which plays a crucial role in immune responses and viral infections. The H2B antibody can be used to detect and quantify virus surface antigens, as well as nuclear proteins involved in gene regulation. Additionally, this antibody has been shown to interact with fatty acid-binding proteins and serine proteases, suggesting its involvement in lipid metabolism and protein processing pathways. Whether you need a monoclonal or polyclonal antibody for your research, the H2B antibody is a reliable tool that provides accurate and reproducible results.
Pureza:Min. 95%FTCD antibody
FTCD antibody was raised using the N terminal of FTCD corresponding to a region with amino acids FSEGKNQEVIDAISGAITQTPGCVLLDVDAGPSTNRTVYTFVGPPECVVE
ZFP36 antibody
The ZFP36 antibody is a polypeptide that belongs to the family of Polyclonal Antibodies. It is also available as a monoclonal antibody. This antibody is widely used in the field of Life Sciences for various research applications. The polyclonal antibodies are produced by immunizing animals with specific antigens, resulting in the production of antibodies that recognize multiple epitopes on the target protein. On the other hand, monoclonal antibodies are produced from a single clone of cells and recognize a specific epitope on the target protein. Both types of antibodies are valuable tools in scientific research for studying protein expression, localization, and function.
Goat anti Rabbit IgG (Texas Red)
Goat anti-rabbit IgG was raised in goat using rabbit IgG F(c) fragment as the immunogen.Pureza:Min. 95%TSGA13 antibody
TSGA13 antibody was raised using the middle region of TSGA13 corresponding to a region with amino acids ASERPISKVIREPLTLASLLEDMPTRTAPGESAFRNGRAPQWIIKKATVI
