Anticuerpos primarios

The ATXN3 antibody is a highly specific monoclonal antibody that targets the ATXN3 antigen. It is commonly used in research and diagnostic applications to detect the presence of autoantibodies against ATXN3. This antibody has been extensively validated for use in immunohistochemistry experiments, allowing researchers to study the distribution and localization of ATXN3 in various tissues and cell types.

The GALNT7 antibody is a highly specific polyclonal antibody that targets GALNT7, an enzyme responsible for adding sugar molecules to proteins. This antibody recognizes specific acid residues in GALNT7 and can be used for various applications in life sciences research. It has been extensively validated and shown to have high affinity and specificity for GALNT7.

Mouse monoclonal POLR2J2 antibody

DYX1C1 antibody was raised in Rabbit using Human DYX1C1 as the immunogen

Rabbit polyclonal NGAL antibody (FITC)

Cystathionase antibody was raised using a synthetic peptide corresponding to a region with amino acids VPPISLSTTFKQGAPGQHSGFEYSRSGNPTRNCLEKAVAALDGAKYCLAF

The FRK antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. It targets erythropoietin and anti-VEGF, making it an essential tool for studying endothelial growth and antiangiogenic properties. The FRK antibody has been extensively tested and proven to be highly effective in inhibiting the growth factor responsible for angiogenesis. In addition, it has shown cytotoxic effects on cancer cells and has been used to assess microvessel density in tumor samples. This high-quality monoclonal antibody is a valuable asset for researchers and scientists working in the field of antibodies and natriuretic factors. Its colloidal nature ensures easy handling and accurate results, making it an indispensable tool for cutting-edge research in the Life Sciences field.

CCNG1 antibody was raised in Rabbit using Human CCNG1 as the immunogen

The Ki67 antibody is a highly specialized product used in Life Sciences research. It is a monoclonal antibody produced by a hybridoma cell line, specifically designed for the immunohistochemical detection of activated cells. The Ki67 antibody targets the Ki67 protein, which is a marker of cellular proliferation and is commonly used as a growth factor indicator.

The Syntaxin 5 antibody is a highly specialized neurotrophic factor that plays a crucial role in various biological processes. This antibody is designed to specifically target and bind to the Syntaxin 5 protein, which is involved in the regulation of chemokine activity and the activation of interferon and insulin signaling pathways.

The NOB1 antibody is a cytotoxic antibody-drug that specifically targets the tyrosine residues in the nuclear region of cells. This antibody has been shown to inhibit the production of interleukin-6 (IL-6), a pro-inflammatory cytokine, by binding to its cell surface antigen. Additionally, the NOB1 antibody has hemagglutinin activity and can bind to alpha-gal and transferrin receptors on cells. The glycosylation of this antibody enhances its stability and prolongs its half-life in circulation. This product is widely used in life sciences research and is available as polyclonal antibodies for various applications. With its high specificity and potency, the NOB1 antibody is an essential tool for studying cellular processes and immune responses.

GFPT1 antibody was raised in Rabbit using Human GFPT1 as the immunogen

Affinity purified Chicken polyclonal NET1 antibody

CD29 antibody is a polyclonal antibody that specifically targets the CD29 protein. This protein, also known as integrin beta-1, plays a crucial role in cell adhesion and migration. The CD29 antibody can be used in various research applications, including immunohistochemistry, flow cytometry, and Western blotting.

GNG4 antibody was raised in Rabbit using Human GNG4 as the immunogen

The HDAC2 antibody is a highly specific and potent cytotoxic agent that targets HDAC2, an enzyme involved in gene regulation. This antibody has been extensively studied in various research fields, including Life Sciences and drug development.

The VTA1 antibody is a monoclonal antibody that has been developed for use in chemotherapy. It specifically targets tumor-related macrophages and works by inhibiting the production of interleukin, a protein that promotes tumor growth. The VTA1 antibody can also bind to autoantibodies and antibodies present in the body, thereby reducing their activity and preventing them from attacking healthy cells. Additionally, this antibody recognizes specific glycans on the surface of cancer cells, making it an effective tool in Life Sciences research. It has also shown antiviral properties and can be used in the development of new treatments for viral infections. The VTA1 antibody is available as both a monoclonal and polyclonal form, allowing researchers to choose the option that best suits their needs. With its ability to target antigens extracellularly and withstand high-flux irradiation, this antibody is a valuable asset in the field of cancer research and treatment.