Anticuerpos primarios
Subcategorías de "Anticuerpos primarios"
- Anticuerpos para la investigación del cáncer(3.620 productos)
- Anticuerpos cardiovasculares(2 productos)
- Biología del desarrollo(751 productos)
- Anticuerpos Epigenéticos(162 productos)
- Anticuerpos inmunológicos(2.551 productos)
- Anticuerpos del metabolismo(279 productos)
- Anticuerpos de microbiología(740 productos)
- Transducción de señales(2.717 productos)
- Etiquetas y marcadores celulares(33 productos)
Se han encontrado 75447 productos de "Anticuerpos primarios"
CD45.2 antibody (PE-CY5.5)
CD45.2 antibody (PE-CY5.5) was raised in mouse using CD45.2 as the immunogen.
Pureza:Min. 95%Influenza B antibody
Influenza B antibody was raised in goat using the yamagata strain of influenza B as the immunogen.Pureza:Min. 95%Pirimiphos antibody
The Pirimiphos antibody is a highly effective antibody-drug that specifically targets TNF-α, a cytokine involved in inflammation and immune response. This polyclonal antibody is widely used in Life Sciences research to study the role of TNF-α and its receptor in various biological processes. It can be used for applications such as immunohistochemistry and Western blotting to detect and quantify TNF-α expression levels. The Pirimiphos antibody can also be conjugated with other molecules, such as doxorubicin, to create targeted therapies for specific diseases. With its high specificity and affinity, this monoclonal antibody offers a powerful tool for researchers studying growth factors, kinases, phosphatases, and carbonyl reductases. Its cytotoxic properties make it an ideal candidate for therapeutic applications aimed at eliminating cells expressing TNF-α.
ABL2 antibody
ABL2 antibody was raised in Mouse using a purified recombinant fragment of ABL2 expressed in E. coli as the immunogen.
ZNF326 antibody
ZNF326 antibody was raised in rabbit using the C terminal of ZNF326 as the immunogen
Pureza:Min. 95%BD3 antibody
BD3 antibody was raised in rabbit using highly pure recombinant human BD-3 as the immunogen.Pureza:Min. 95%SLC7A11 antibody
SLC7A11 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.
Pureza:Min. 95%SCAP antibody
The SCAP antibody is a powerful tool in the field of Life Sciences. It is a monoclonal antibody that can be used for immobilization on electrodes, making it ideal for various research applications. This antibody specifically targets and binds to SCAP (Sterol Regulatory Element-Binding Protein Cleavage-Activating Protein), which plays a crucial role in cholesterol metabolism and lipid homeostasis. By targeting SCAP, researchers can gain valuable insights into the regulation of these processes.
SITPEC antibody
SITPEC antibody was raised in rabbit using the middle region of SITPEC as the immunogen
Pureza:Min. 95%Calbindin antibody (D28K)
Calbindin antibody (D28K) was raised in rabbit using recombinant rat Calbindin D-28K as the immunogen.Pureza:Min. 95%Shpk antibody
Shpk antibody was raised in rabbit using the middle region of Shpk as the immunogen
Pureza:Min. 95%Rat RBC antibody
Rat RBC antibody was raised in rabbit using rat erythrocytes as the immunogen.Pureza:Min. 95%YBX1 antibody
The YBX1 antibody is a highly specialized diagnostic reagent used in the field of Life Sciences. It is an antibody that specifically targets the YBX1 protein, which plays a crucial role in various cellular functions including protein-protein interactions and regulation of gene expression. This antibody can be used in flow immunoassays to detect the presence of YBX1 in human serum or other biological samples.
Syntrophin Beta 1 antibody
Syntrophin Beta 1 antibody was raised using a synthetic peptide corresponding to a region with amino acids GAGAGHPGAGGAQPPDSPAGVRTAFTDLPEQVPESISNQKRGVKVLKQELPureza:Min. 95%
