
Péptidos
Subcategorías de "Péptidos"
Se han encontrado 29874 productos de "Péptidos"
H-FNWY^VDGVEVHNAK^-OH
Peptide H-FNWY^VDGVEVHNAK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Fmoc-Cys(Trt)-OH
CAS:Fmoc-Cys(Trt)-OH is a chemical compound that has been shown to have potent antitumor activity in mice. It is synthesized by the stepwise addition of amino acids to the resin-bound Cys residue in the presence of trifluoroacetic acid and a coupling agent such as EDC. This reaction produces a functional protein with an amide bond. The acetylcholine receptor binding properties of Fmoc-Cys(Trt)-OH are due to its ability to form a disulfide bond with cysteine residues on the receptor.Fórmula:C37H31NO4SPureza:Min. 98.0 Area-%Peso molecular:585.71 g/molBivalirudin
CAS:Bivalirudin is a synthetic cyclic peptide that binds to the ATP-binding cassette transporter and inhibits the activity of the proteolytic enzyme, angiotensin-converting enzyme (ACE). ACE inhibition prevents the conversion of angiotensin I to angiotensin II. Bivalirudin has been shown to be effective in reducing mortality in patients with acute coronary syndrome or undergoing percutaneous coronary intervention. It has also been shown to have pharmacokinetic properties that are similar to those of heparin. The drug has a low dose and is not associated with an increased risk of bleeding. Bivalirudin is an inhibitor and can cause drug interactions when combined with other drugs that are inhibitors or substrates for this type of transporter.
Fórmula:C98H138N24O33Pureza:Min. 95%Peso molecular:2,180.33 g/molGly-Ala-Asp-Gly-Val-Gly-Lys-Ser-Ala-Leu
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFórmula:C36H63N11O14Peso molecular:873.95 g/molNeuropeptide S (Human)
CAS:Neuropeptide S is a neuropeptide and a novel modulator of arousal and anxiety. This neuropeptide is found in the mammalian brain and is also involved in the suppression of food intake, reward-like effects, mediation of fear expression and memory and learning processes. This product can be used in pharmacological research and is available as a 0.5 mg vial.Fórmula:C93H155N31O28SPureza:Min. 95%Peso molecular:2,187.5 g/molH-IVGGWECEK^-OH
Peptide H-IVGGWECEK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Enterotoxin STp
CAS:Enterotoxin STp is an Escherichia coli Enterotoxin, with the following disulfide bonds: Cys5 and Cys10; Cys6 and Cys14; Cys9 and Cys17 and available as the trifluoroacetate salt.
One-Letter-Code: H-NTFYCCELCCNPACAGCY-OHFórmula:C81H110N20O26S6Pureza:Min. 95%Peso molecular:1,972.26 g/molDabcyl-Leu-Ala-Gln-Ala-Val-Arg-Ser-Ser-Ser-Arg-Edans
CAS:TNF-a is shed from cell membranes by TNF-a-FW cleaving enzyme (TACE). Incubation of the TACE substrate with recombinant human TACE gives a specific cleavage to restore the quenched fluorescence. The substrate is widely used to screen inhibitors of TNF-α converting enzyme (TACE, ADAM17 endopeptidase) activity. On application is its use as a TACE FRET Substrate I and it is available as a Trifluoroacetate Salt.Fórmula:C70H104N22O18SPureza:Min. 95%Peso molecular:1,573.81 g/molH-AKPEAPGEDASPEEL^SRYYASL^RHYL^NLVTRQRY-NH2
H-AKPEAPGEDASPEELSRYYASLRHYLNLVTRQRY-NH2 is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote ToolFórmula:C190H288N54O57Peso molecular:4,240.7 g/molH-DESGLPQLTSYDAEVN^^APIQGSRNLLQGEELLRALDQVN-OH
Peptide H-DESGLPQLTSYDAEVN^^APIQGSRNLLQGEELLRALDQVN-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-HSQGTFTSDYSK^YLDSRRAQDFVQWLMNTKR^NRNNIA-OH
H-HSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIA-OH is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote ToolFórmula:C192H295N61O60SPeso molecular:4,449.9 g/molFmoc-D-Lys(Boc)-OH
CAS:Fmoc-D-Lys(Boc)-OH is a building block for the synthesis of peptides. It can be used to synthesize chains that are up to 17 amino acids long. Fmoc-D-Lys(Boc)-OH is a protected amino acid with an active group on the alpha carbon and has been used in the synthesis of ganirelix acetate, a peptide that is used in the treatment of prostate cancer. The Boc group is an organic compound that protects the lysine side chain from reacting with other compounds. The Fmoc group is also an organic compound, which helps to protect the side chain from reactions with other compounds. These groups are removed at different stages of synthesis, depending on what type of reaction needs to take place next.
Fórmula:C26H32N2O6Pureza:Min. 95%Peso molecular:468.55 g/molMOCAc-Lys-Pro-Leu-Gly-Leu-Dap(Dnp)-Ala-Arg-NH2
CAS:MOCAc-Lys-Pro-Leu-Gly-Leu-Dap(Dnp)-Ala-Arg-NH2 is a peptide that has been shown to inhibit the activity of ADAM17. It blocks the cleavage of proMMP1, MMP2, and MMP9 and inhibits collagenase, stromelysin, and cathepsin activities. This peptide may be useful for the prevention and treatment of diseases associated with excessive proteolytic activity such as arthritis or cancer.Fórmula:C55H80N16O16Pureza:Min. 95%Peso molecular:1,221.35 g/molAminomethylated Polystyrene Resin • HCl (200-400 mesh) 1% DVB
Aminomethylated Polystyrene Resin • HCl (200-400 mesh) 1% DVB is a purified solid resin that has been chemically modified with amine groups. This product can be used as an inhibitor, activator, or ligand in research applications. Aminomethylated Polystyrene Resin • HCl (200-400 mesh) 1% DVB is also useful as a reagent for Protein interactions and Receptor binding studies. It is available in high purity and can be used as a research tool in Cell Biology and Pharmacology experiments.Pureza:Min. 95%LCBiot-IQKEIDRLNEVAKNLNESLI-OH
Peptide LCBiot-IQKEIDRLNEVAKNLNESLI-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
LCBiot-HASARQQWEL-OH
Peptide LCBiot-HASARQQWEL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-NAVEVLKR^-OH
Peptide H-NAVEVLKR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.gp100 (86-95)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
H-STDYGIFQINSR^-OH
Peptide H-STDYGIFQINSR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-Gly-Pro-Arg-Pro-OH
CAS:Producto controladoH-Gly-Pro-Arg-Pro-OH is a sealant that has been shown to be effective in the treatment of bowel disease. It is a calcium binding compound that can be administered topically or systemically. H-Gly-Pro-Arg-Pro-OH has clinical relevance in vivo with human beings and exhibits ATP levels that are similar to those found in normal tissue. The surface glycoprotein of this compound has been shown to have an affinity for epidermal growth factor, which may play a role in inflammatory bowel disease. HGPAROH is activated by fibrinogen, which leads to its bound form being recognized by monoclonal antibody as well as the human serum proteins (e.g., albumin).Fórmula:C18H31N7O5Pureza:Min. 95%Peso molecular:425.48 g/molLinaclotide
CAS:Linaclotide is a peptide drug that has been shown to be effective in treating chronic constipation. It belongs to the class of pharmacological agents and is used as a treatment for bowel disease, specifically chronic idiopathic constipation. Linaclotide increases the frequency of bowel movements by acting on the ileum and colon. This drug has been shown to be safe for use in pregnant women and children, with no adverse effects observed at doses up to 100 mcg/kg/day. The most common side effect is diarrhea, which can be managed with dietary changes or other medications. Linaclotide has not been found to interact with other drugs, but patients should always consult their doctor before taking any new medication while on linaclotide.Fórmula:C59H79N15O21S6Pureza:Min. 95%Peso molecular:1,526.76 g/molPoly-L-Lysine Hydrobromide
CAS:Poly-L-Lysine Hydrobromide is a neurotrophic factor that is used to stimulate nerve growth in the peripheral nervous system. It has been shown to increase the production of nerve growth factor, which is important for neuronal development and regeneration. Poly-L-Lysine Hydrobromide also has biological properties against human erythrocytes, enabling it to bind to the erythrocyte membrane and subsequently cause hemolysis. This process is mediated by Toll-like receptors. The active form of this drug has been shown to have antiviral activity against HIV and other viruses in transfection experiments using cells from mice, as well as an ability to inhibit replication of herpes simplex virus type 1 (HSV-1) in a model system consisting of rat neurons grown on a polymer substrate. Poly-L-Lysine Hydrobromide can be cleaved into smaller pieces by enzymes such as DNase I or terminal transferases, forming polymers
Pureza:Min. 95%Abz-Ala-Gly-Leu-Ala-p-Nitro-Benzyl-Amide
CAS:Abz-Ala-Gly-Leu-Ala-p-Nitro-Benzyl-Amide is an enzyme inhibitor that is used to treat cancer. It is a potent and selective inhibitor of neutral endopeptidase, which is an enzyme involved in the process of inflammation. Abz-Ala-Gly-Leu-Ala-p-Nitro-Benzyl Amide can be used to inhibit the interaction between gram negative bacteria and human cells, and has been shown to have antimicrobial properties against Pseudomonas aeruginosa. This compound may also be able to modulate metalloendopeptidases, which are resistant to endopeptidases.
Fórmula:C28H37N7O7Pureza:Min. 95%Peso molecular:583.64 g/molp-Methyl-Benzhydrylamine Resin•HCl (200-400 mesh) 1% DVB
MBHA resin is a solid phase synthesis material that is used as a building block in the synthesis of peptides. The resin is a very stable, insoluble polymer with a high capacity for binding amino acids. MBHA resin provides a clean surface for peptide synthesis and an efficient coupling reaction. It can be used to make any type of peptide, including natural and unnatural amino acids and modified amino acids.Pureza:Min. 95%H-IGGHGAEYGAEALER^-OH
Peptide H-IGGHGAEYGAEALER^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-LHGGSPWPPCQYR^-OH
Peptide H-LHGGSPWPPCQYR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Boc-Tyr(Br-Z)-OH
CAS:Boc-Tyr(Br-Z)-OH is a research tool used in the study of protein interactions and receptor pharmacology. It is an ion channel activator that binds to the Ligand-gated Ion channel receptor. Boc-Tyr(Br-Z)-OH has been shown to increase the rate of potassium ion permeability through the channel, which is associated with pain perception. This ligand also decreases calcium ion permeability, which may be beneficial for some conditions such as epilepsy or cardiac arrhythmia.
Fórmula:C22H24NO7BrPureza:Min. 95%Peso molecular:494.33 g/molFmoc-D-Pro-OH
CAS:Fmoc-D-Pro-OH is a building block for peptide synthesis. It is a protected form of proline with an amido group, which can be used to synthesize polypeptides. Fmoc-D-Pro-OH can be coupled with other amino acids using the aldol condensation or methodologies like the strategy of organocatalysts. This building block is also useful in the synthesis of macrocycles and cyclohexanones, which are aliphatic and cyclic compounds. The recoverable nature of Fmoc-D-Pro-OH allows it to be reused in multiple reactions, so it is an economical choice for Building Blocks.
Fórmula:C20H19NO4Pureza:Min. 95%Peso molecular:337.38 g/molBig Endothelin-1 (Porcine, 1-39)
CAS:This product has disulfide Bonds between Cys1-Cys15 and Cys3-Cys11, is sourced from: Porcine, 1-39 and is available as a 0.1mg vial. Big Endothelin-1 (Porcine, 1-39) is a precursor peptide of the vasoconstrictor Endothelin-1 (ET-1). ET-1 exhibits vasoconstrictive properties and is an activator of endothelin G-protein coupled receptors. Furthermore ET-1 is produced when inflammation, vascular stress or hypoxia occurs. In vivo Big Endothelin-1 has a greater half life compared to ET-1 and therefore makes it useful to study secretory activity in the endothelial system. Overall Big Endothelin-1 (Porcine, 1-39) can be used as a research tool for studying protein interactions, receptor activation and function, and ligand binding. This peptide is also used in pharmacology to study the effects of therapeutic agents on receptor activity and expression.Fórmula:C193H289N49O58S5Pureza:Min. 95%Peso molecular:4,384 g/molAc-CQLINTNGSWHINCK-NH2
Peptide Ac-CQLINTNGSWHINCK-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Fmoc-Thr(tBu)-OH
CAS:Fmoc-Thr(tBu)-OH is an amino acid that is used for the synthesis of amides and esters. It is prepared by the solid-phase synthesis of 2,6-dichloroacetic acid and Fmoc-protected thiomorpholine. The product can be purified by a combination of saponification and trifluoroacetic acid hydrolysis. This amino acid has acidic properties, which may be due to its ability to form ester or amide bonds with other compounds in the presence of a base.
Fórmula:C23H27NO5Pureza:Min. 98.0 Area-%Peso molecular:397.48 g/molH-IPAMVVDR^-OH
Peptide H-IPAMVVDR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Elastatinal
CAS:Elastatinal is a natural product that has been shown to inhibit the protease activity of HIV-1. This inhibition may be due to its ability to bind to the cell surface and prevent the assembly of the virus-cell complex. Elastatinal binds to hydroxyl groups on proteins, which may inhibit enzymes in cells by preventing them from carrying out their functions. The biological sample can be any type of biological fluid or tissue, such as blood, saliva, semen, and vaginal secretions. Elastatinal is a natural product that has been shown to inhibit the protease activity of HIV-1. This inhibition may be due to its ability to bind to the cell surface and prevent the assembly of the virus-cell complex. Elastatinal binds to hydroxyl groups on proteins, which may inhibit enzymes in cells by preventing them from carrying out their functions. The biological sample can be any type of biological fluid or tissue, such as blood, saliva, semen, and
Fórmula:C21H36N8O7Pureza:Min. 95%Peso molecular:512.56 g/molBiotinyl-Asp-Glu-Val-Asp-H (aldehyde)
CAS:Biotinyl-Asp-Glu-Val-Asp-H (aldehyde) is a peptide that has been used as a research tool for the study of ion channels and protein interactions. It has an affinity for the receptor site on cell membranes, which may be due to its ability to act as an inhibitor or ligand. This peptide has been shown to bind to the acetylcholine receptor, which is involved in neurotransmission and nerve function. Biotinyl-Asp-Glu-Val-Asp-H (aldehyde) binds with high specificity to the receptor site and blocks the binding of acetylcholine, inhibiting nerve transmission.Fórmula:C28H42N6O12SPureza:Min. 95%Peso molecular:686.73 g/molH-GLQTSQDAR^-OH
Peptide H-GLQTSQDAR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-YTIAALLSPYSYSTTAVVTNPK^E-OH
Peptide H-YTIAALLSPYSYSTTAVVTNPK^E-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Dabcyl-γ-Abu-Ile-His-Pro-Phe-His-Leu-Val-Ile-His-Thr-Edans
CAS:Producto controladoDabcyl-γ-Abu-Ile-His-Pro-Phe-His-Leu-Val-Ile-His-Thr-Edans is an angiotensinogen peptide. It has been used as a substrate for Renin and assayed by fluorescence to study the binding affinity of protease inhibitors. Dabcyl is a fluorescent label that can be used in peptide and biochemicals assays, including fluorescence assay. Dabcyl is soluble in water and has little fluorescence quenching with other compounds, making it ideal for use in these applications.Fórmula:C90H120N22O16SPureza:Min. 95%Peso molecular:1,798.16 g/molH-DTHFPICIFCCGCCHRSKCGMCCK^T-OH
Peptide H-DTHFPICIFCCGCCHRSKCGMCCK^T-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-LSITIRPR^-OH
Peptide H-LSITIRPR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Insulin (Human)
CAS:Insulin is a peptide hormone that regulates the uptake and storage of glucose by muscle and fat cells. Insulin is produced by beta cells in the pancreas, which release it into the bloodstream when blood sugar levels rise. Insulin lowers glucose levels by increasing the amount of glucose taken up from the blood into muscle and fat cells, suppressing hepatic gluconeogenesis, and promoting glycolysis. It also increases protein synthesis, decreases proteolysis, and stimulates growth. With a molecular weight of 5808 Da, insulin is composed of two polypeptide chains with an approximate molecular weight of 3120 Da each linked by disulfide bonds. Insulin has no lipid moiety or carbohydrate moiety.
Insulin binds to its receptor on the surface of a cell to trigger one or more signaling cascades leading to changes in metabolism. Binding to the receptor triggers a conformational change in the receptor that causes insulin to be released from its binding site on the receptor.Fórmula:C257H383N65O77S6Pureza:Min. 95%Peso molecular:5,807.6 g/molFor-Met-Leu-pNA
CAS:For-Met-Leu-pNA is a synthetic peptide that can be used as a research tool for studying protein interactions. It has been shown to inhibit ion channels and may be useful in the treatment of epilepsy, especially in cases of drug resistant seizures. For-Met-Leu-pNA is also an inhibitor and can be used as an anticonvulsant.
Fórmula:C18H26N4O5SPureza:Min. 95%Peso molecular:410.5 g/molGalactosyl-Cyclo(Arg-Gly-Asp-D-Phe-Lys)
CAS:Galactosyl-Cyclo(Arg-Gly-Asp-D-Phe-Lys) is a monoclonal antibody that binds to the integrin receptor, which is involved in the proliferation and migration of cells. It has been shown to be an effective treatment for prostate cancer cells in vitro. Galactosyl-Cyclo(Arg-Gly-Asp-D-Phe-Lys) also shows potential as a biomarker for atherosclerotic lesions. The drug has been shown to have pharmacokinetic properties in humans and can inhibit epidermal growth factor (EGF) activity.
Fórmula:C34H52N10O12Pureza:Min. 95%Peso molecular:792.85 g/molH-DQFPEVYVPTVFENYVADIEVDGK^-OH
Peptide H-DQFPEVYVPTVFENYVADIEVDGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Fmoc-D-Ile-OH
CAS:Fmoc-D-Ile-OH is a peptide that inhibits the activation of protein interactions. It is also used as a research tool to study the binding of ligands to receptors. Fmoc-D-Ile-OH has been shown to bind to ion channels, such as nicotinic acetylcholine receptor and voltage gated potassium channels. This inhibitor has also been shown to bind with high affinity to a receptor with unknown identity.
Fórmula:C21H23NO4Pureza:Min. 95%Peso molecular:353.42 g/molH-Ser-Phe-Leu-Leu-Arg-Asn-Pro-OH
CAS:H-Ser-Phe-Leu-Leu-Arg-Asn-Pro-OH is a biocompatible polymer that has significant cytotoxicity. It is a pharmacological treatment for infectious diseases, cancer, and brain functions. This polymer has been shown to be effective in the experimental model of atherosclerosis and also induces neuronal death in the low dose group. H-Ser-Phe-Leu-Leu-Arg-Asn Pro OH is a signal peptide that is involved in physiological effects such as cell proliferation, apoptosis, and angiogenesis.Fórmula:C39H63N11O10Pureza:Min. 95%Peso molecular:845.99 g/molHCTU Reagent
CAS:HCTU Reagent is an organic compound that is used for diagnosis of infectious diseases, chemical biology, and polymerase chain reaction. It is a disulfide bond-forming reagent that contains two reactive thiols and can be used to form a disulfide bond between two cysteine residues. HCTU Reagent has been shown to be effective in the treatment of prostate cancer cells by inhibiting the growth factor-β1 receptor and preventing the binding of heme to its intracellular site. This reagent also binds to iron and has conformational properties that are important for cyclic lipopeptides.Fórmula:C11H15N5OClPF6Pureza:Min. 98.0 Area-%Peso molecular:413.69 g/molFmoc-FAVP
Peptide Fmoc-FAVP is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.FRETS-25-STD2 (1 umol)
FRETS-25-STD2 is a peptide that is used in pharmacology, cell biology, and research. It acts as an activator of ion channels and receptor proteins. FRETS-25-STD2 also has the ability to inhibit ligand binding to receptors. This product is made up of 25 amino acids and has a purity of 1 umol.Fórmula:C41H61N15O11Pureza:Min. 95%Peso molecular:940.02 g/molH-WYQSIR^-OH
Peptide H-WYQSIR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-ESTLGFVDLLR^-OH
Peptide H-ESTLGFVDLLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Oxyntomodulin, Glucagon-37 (Human, Mouse, Rat)
CAS:Oxyntomodulin, Glucagon-37 (Human, Mouse, Rat) is an inhibitor of gastric acid secretion and pancreatic enzyme secretion and has been shown to reduce food intake and increase energy expenditure in humans. This product is available in the trifluoroacetate salt form. One letter code: HSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIAFórmula:C192H295N61O60SPureza:Min. 95%Peso molecular:4,449.93 g/molEnterocin RJ-11
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Fmoc-11-aminoundecanoic acid
CAS:Fmoc-11-Aminoundecanoic Acid is a molecular modeling reagent that interacts with other elements to form Building Blocks. Fmoc-11-Aminoundecanoic Acid has been shown to have cancer interacting properties, elucidating the molecular interactions of peptides and proteins. It has been used in research as an active analog for growth factors. Fmoc-11-Aminoundecanoic Acid interacts with other molecules, including peptides and proteins, by proteolysis to produce new molecules. The chemical structure of this molecule can be altered through reactions with other molecules such as amino acids or nucleotides.
Fórmula:C26H33NO4Pureza:Min. 98.0 Area-%Peso molecular:423.56 g/molFmoc-D-His(Trt)-OH
CAS:Fmoc-D-His(Trt)-OH is a chiral building block that is used in peptide synthesis. It can be used to synthesize an enantiomer or homologue of the original amino acid. Fmoc-D-His(Trt)-OH has been postulated to exist as two stereoisomers, 1R,2S and 2R,1S. The 1R,2S enantiomer is the naturally occurring form of this compound and is produced with a shift of +6 ppm in the proton NMR spectrum. The 2R,1S enantiomer has also been observed in the solid state but not in solution and it exhibits a shift of -6 ppm in the proton NMR spectrum. Fmoc-D-His(Trt)-OH is soluble in solvents such as DMSO and DMF. It has also been shown to be a potent inhibitor of organophosphate and reFórmula:C40H33N3O4Pureza:Min. 95%Peso molecular:619.73 g/molH-DMQLGR^-OH
Peptide H-DMQLGR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Tertiapin Q
CAS:Tertiapin Q is a peptide inhibitor, a derivative of tertiapin, from honeybee venom (specifically Apis mellifera). This peptide acts by specifically blocking certain potassium channels, namely Kir1.1 and Kir3.1/3.4. The mode of action involves binding to the outer mouth of the potassium channel pore, effectively inhibiting ion flow through these channels. Tertiapin Q varies from native tertiapin by one amino acid, where a methionine residue is replaced with a glutamine residue. This means that unlike native TPN, TPN(Q) is not air oxidizable.Tertiapin : H-Ala-Leu-Cys-Asn-Cys-Asn-Arg-Ile-Ile-Ile-Pro-His-Met-Cys-Trp-Lys-Lys-Cys-Gly-Lys-Lys-NH2Tertiapin Q: H-Ala-Leu-Cys-Asn-Cys-Asn-Arg-Ile-Ile-Ile-Pro-His-Gln-Cys-Trp-Lys-Lys-Cys-Gly-Lys-Lys-NH2Tertiapin Q is used in electrophysiological research to study the role and regulation of inward-rectifier potassium channels in various physiological and pathological processes. Its specificity and potency make it an invaluable tool in the exploration of renal physiology and cardiac cellular activity, as well as in neuroscience research for understanding neuronal excitability.
Fórmula:C106H175N35O24S4Pureza:Min. 95%Peso molecular:2,452.05 g/molAc-CYEQPKYTPEKETLE-NH2
Peptide Ac-CYEQPKYTPEKETLE-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-R^F-OH
Peptide H-R^F-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-GFYFNKPTGYGSSSR^-OH
Peptide H-GFYFNKPTGYGSSSR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-Gly-Arg-Gly-Asp-Ser-Pro-Cys-OH
CAS:H-Gly-Arg-Gly-Asp-Ser-Pro-Cys-OH is a monoclonal antibody (mAb) that binds to the cell surface receptor, TGFβRI. It has been shown to exhibit biological activities including inhibition of tumor growth and induction of apoptosis in cancer cells. This mAb can be used as a tumor treatment and can also inhibit the proliferation of cells in tissue culture. H-Gly-Arg-Gly-Asp-Ser-Pro-Cys has been shown to inhibit the production of collagen, which may be due to its ability to block integrin activation by binding to the cell surface receptor, αVβ3. HGRGSSPC has also been found to have antiangiogenic properties, which may be due to its ability to bind with high affinity and specificity to αVβ3 on endothelial cells.
Fórmula:C23H42N10O11SPureza:Min. 95%Peso molecular:690.74 g/molH-Pro-Asp-OH
CAS:H-Pro-Asp-OH is a conjugate of the amino acid proline and aspartic acid. H-Pro-Asp-OH is synthesized in the liver, where it can be found in the extracellular environment. This drug has been shown to be effective against hyperproliferative disorders and cancer. H-Pro-Asp-OH binds to the surface of cells, which inhibits the growth rate of cancer cells by inhibiting the synthesis of DNA, RNA, and proteins. The uptake of this drug by cells is increased when dietary protein levels are low. H-Pro-Asp-OH has also been shown to inhibit cell proliferation in humans and pigs.Fórmula:C9H14N2O5Pureza:Min. 95%Forma y color:White PowderPeso molecular:230.22 g/molH-PRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPR-OH
H-PRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPR-OH is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote ToolFórmula:C275H477N125O51Peso molecular:6,350.54 g/molH-LDSIICVK^-OH
Peptide H-LDSIICVK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-TAVEQAAAELGDTGR^-OH
Peptide H-TAVEQAAAELGDTGR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.LCBiot-KKRYDREFLLGF-OH
Peptide LCBiot-KKRYDREFLLGF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.(Ala1)-PAR-4 (1-6) amide (mouse)
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFórmula:C34H48N8O7Peso molecular:680.8 g/molAc-Arg-Gly-Lys(Ac)-MCA
CAS:Ac-Arg-Gly-Lys(Ac)-MCA is a peptide that is used as a histone deacetylase substrate. It is an enzyme substrate in the histone deacetylase reaction and it has been shown to inhibit the growth of many bacterial strains. Ac-Arg-Gly-Lys(Ac)-MCA has been shown to inhibit the growth of Staphylococcus aureus, Bacillus subtilis, and Pseudomonas aeruginosa.
Fórmula:C28H40N8O7Pureza:Min. 95%Peso molecular:600.68 g/molH-VDSALYLGSR^-OH
Peptide H-VDSALYLGSR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.HRKy peptide
HRK-Y is a synthetic BH3 peptide that selectively antagonizes BCL-XL, a pro-survival protein of the Bcl-2 family. This interaction disrupts the balance of Bcl-2 family proteins, leading to cytochrome c release and subsequent apoptosis in susceptible cancer cells. HRK-Y is utilized in BH3 profiling assays to assess the sensitivity of cancer cells to BH3-mimetic drugs and to identify potential synergistic effects with NK cell-based therapies.TBTU Reagent
CAS:TBTU Reagent is a combination of two reagents that are used for peptide synthesis and purification. TBTU is an amide coupling reagent that reacts with the carboxyl group of an ester to form a reactive intermediate, which then reacts with the amino group of an amide. This reaction forms an amide bond between the carboxyl group of the ester and the amino group of the amide. TBTU Reagent has been used in vitro assays to measure pharmacological activities such as anti-inflammatory effects and antimicrobial effects. TBTU Reagent has also been used to prepare mouse monoclonal antibodies against toll-like receptor 4 (TLR4).Fórmula:C11H16N5OBF4Pureza:Min. 95%Peso molecular:321.08 g/molH-YTDV^SNMSHLA-OH
Peptide H-YTDV^SNMSHLA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Fmoc-D-Tyr(tBu)-OH
CAS:Please enquire for more information about Fmoc-D-Tyr(tBu)-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page
Fórmula:C28H29NO5Pureza:Min. 95%Peso molecular:459.55 g/molH-FGVAPDHPEVK^-OH
Peptide H-FGVAPDHPEVK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-NEQEQPL^GQWHL^S-OH
Peptide H-NEQEQPL^GQWHL^S-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-IDEALER^-OH
Peptide H-IDEALER^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-SGLSTGWTQLSK^-OH
Peptide H-SGLSTGWTQLSK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-TASSYFTNMFATWSPSKARL-NH2
Peptide H-TASSYFTNMFATWSPSKARL-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-AKPEAPGEDASPEEL^SRYYASL^RHYL^NLVTRQRY-OH
H-AKPEAPGEDASPEELSRYYASLRHYLNLVTRQRY-OH is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote ToolFórmula:C190H288N54O57Peso molecular:4,240.7 g/molAoa-KRRGSTCVLA-NH2
Peptide Aoa-KRRGSTCVLA-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-DLSLEEIQK^-OH
Peptide H-DLSLEEIQK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-SIAFSR^-OH
Peptide H-SIAFSR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-YARAAARQARAHPRNPARRTPGTRRGAPAA-NH2
Peptide H-YARAAARQARAHPRNPARRTPGTRRGAPAA-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-EGYLQIGANTQAAQK^-OH
Peptide H-EGYLQIGANTQAAQK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.LL-37 amide
CAS:LL-37 is a member of the large cationic family of anti-microbial peptides called cathelicidins which have broad-spectrum anti-microbial activity and are expressed in many species. The only cathelicidin found in humans is LL-37, this is produced in epithelial cells, by proteolytic cleavage from the C-terminal of the hCAP-18 protein. LL-37 can be processed into different forms of anti-microbial peptides. As well as its anti-microbial properties LL-37 also regulates many aspects of the innate immune system and overexpression of LL-37 has been linked to autoimmune diseases such as asthma and psoriasis, making LL-37 the most studied form of the human cathelicidin peptides.More recently, studies have shown that LL-37 binds to SARS-CoV-2 S protein and inhibits binding to its receptor hACE2, which may inhibit viral entry into the cell. LL-37 is upregulated by vitamin D, therefore this may be one mode of action for the positive outcomes seen with vitamin D treatment for Covid-19.Fórmula:C205H341N61O52Peso molecular:4,493.3 g/mol2-Furoyl-LIGRLO-amide acetate salt
CAS:2-Furoyl-Leu-Ile-Gly-Arg-Leu-Orn-NH2 is a synthetic peptide that binds to the 5HT3 receptor. It has been shown to have an effect on locomotor activity and growth factor secretion in wild type mice and cell culture, as well as binding to acetylcholine receptors in C57/BL6 mice. 2-Furoyl-Leu-Ile-Gly-Arg-Leu-Orn was synthesized by the reaction of furoic acid with L -alanine, L -glycine, L -arginine and L -ornithine. The product is a white powder.Fórmula:C36H63N11O8Pureza:Min. 95%Peso molecular:777.96 g/molMarfey's reagent
CAS:Marfey's reagent is a mixture of l-tartaric acid, hydrochloric acid and trifluoroacetic acid. It is used to determine the presence of β-amino acids in urine samples by reacting with the amide group on the β-amino acid. The reaction produces a white precipitate that can be filtered and analyzed using a UV spectrophotometer or LC/MS/MS. Marfey's reagent has significant cytotoxicity and should not be used in cell culture experiments.Fórmula:C9H9FN4O5Pureza:Min. 95%Peso molecular:272.19 g/molH-YWGVASFLQK^-OH
Peptide H-YWGVASFLQK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.LCBiot-DWEYS-OH
Peptide LCBiot-DWEYS-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
HBTU Reagent
CAS:HBTU is a reagent that is used in the synthesis of peptides. It has been shown to have inhibitory properties and stable complexes with ester linkages. HBTU has been shown to have a negative effect on congestive heart disease, which may be due to its ability to bind to receptors and mimic the effects of peptide hormones. This compound is also used as a model system for mitochondrial membrane potential. HBTU binds covalently to the peptide hormone receptor, which slows down the rate of degradation and increases its resistance to proteases. HBTU can also be used as an immunosuppressant drug in animal models of autoimmune diseases by inhibiting T-cell proliferation and cytokine production.
Fórmula:C11H16N5OPF6Pureza:Min. 95%Peso molecular:379.25 g/molFmoc-His(Trt)-OH
CAS:Fmoc-His(Trt)-OH is a synthetic antimicrobial peptide that belongs to the class of acetylcholine. The peptide was found to inhibit the growth of a number of bacterial genera, including Pseudomonas, Acinetobacter and Burkholderia. The sequence of Fmoc-His(Trt)-OH is acetylated at the N-terminus and amidated at the C-terminus. This peptide has been found to have a broad spectrum of activity against drug resistant bacteria. It has also been shown to be active against mammalian cells in addition to bacterial cells, suggesting it may have therapeutic potential for humans as well as animals.
Fórmula:C40H33N3O4Pureza:Min. 98.0 Area-%Peso molecular:619.73 g/molCyclo(Arg-Ala-Asp-D-Phe-Val)
CAS:Cyclo(Arg-Ala-Asp-D-Phe-Val) is an active, cyclic peptide that has been shown to have localized effects on the metaphase, meiosis, and gamete cells. Cyclo(Arg-Ala-Asp-D-Phe-Val) is a cilengitide, which are small molecules that bind to calcium ions and increase intracellular levels of calcium. This leads to the activation of biochemical pathways in cells. Cyclo(Arg-Ala-Asp-D-Phe-Val) has been shown to have a diacylglycerol antagonist effect in porcine oocytes and was used in clinical trials for the treatment of infertility. Cyclo(Arg-Ala-Asp-D-Phe Val) also has apoptotic activity in cancer cells.
Fórmula:C27H40N8O7Pureza:Min. 95%Peso molecular:588.68 g/molH-A^LPAPIEK-OH
Peptide H-A^LPAPIEK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-VTSPNITVTLK^-OH
Peptide H-VTSPNITVTLK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Boc-Dap-OtBu hydrochloride salt
CAS:Boc-Dap-OtBu hydrochloride salt is a chemical that is synthesized by anhydride and trifluoroacetic acid. It can be used in the laboratory for protein visualization, as well as to detect proteins using LC-MS. The presence of trifluoroacetic acid makes the Boc-Dap-OtBu hydrochloride salt fluorescent, which makes it possible to visualize the reaction products under UV light. This chemical is often used in fluorescence spectrometry to identify amino acids and other compounds.Fórmula:C12H24N2O4Pureza:Min. 95%Forma y color:PowderPeso molecular:260.33 g/molH-STSGGTAALGCL^VK-OH
Peptide H-STSGGTAALGCL^VK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-EALDESIPPVSFWR^-OH
Peptide H-EALDESIPPVSFWR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-SYSMEHF^RWGKPV-NH2
Peptide H-SYSMEHF^RWGKPV-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Ac-CSHRKSLPKAD-OH
Peptide Ac-CSHRKSLPKAD-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-GDLIAEVETDK^ATV-OH
Peptide H-GDLIAEVETDK^ATV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
