Péptidos
Subcategorías de "Péptidos"
Se han encontrado 29662 productos de "Péptidos"
Fluorescein-6-carbonyl-Ala-Glu(OMe)-Val-DL-Asp(OMe)-fluoromethylketone
CAS:Please enquire for more information about Fluorescein-6-carbonyl-Ala-Glu(OMe)-Val-DL-Asp(OMe)-fluoromethylketone including the price, delivery time and more detailed product information at the technical inquiry form on this page
Fórmula:C41H43FN4O14Pureza:Min. 95%Peso molecular:834.8 g/molRef: 3D-FF111115
Producto descatalogadoFMRF-related peptide, Lymnaea heptapeptide
Catalogue peptide; min. 95% purity
Fórmula:C41H59N11O9Peso molecular:850.00 g/molbeta-Endorphin (27-31) (human)
Catalogue peptide; min. 95% purity
Fórmula:C28H45N7O9Peso molecular:623.71 g/molMSP-1 P2, Malaria Merozoite Surface Peptide-1
Catalogue peptide; min. 95% purity
Fórmula:C116H190N32O35SPeso molecular:2,625 g/molbeta-Amyloid (7-22)
Catalogue peptide; min. 95% purity
Fórmula:C88H124N22O26Peso molecular:2,466 g/mol[D-Tyr27,36, D-Thr32]-Neuropeptide Y, human
Catalogue peptide; min. 95% purity
Fórmula:C189H285N55O57SPeso molecular:4,271.67 g/molBiotin-Bradykinin
Catalogue peptide; min. 95% purity
Fórmula:C60H87N17O13SPeso molecular:1,286.53 g/molNTB (Naltriben)
Catalogue peptide; min. 95% purity
Fórmula:C50H65N11O11S2Peso molecular:1,060.29 g/molIL34 Human, His
IL34 Human Recombinant produced in E.Coli is a single, non-glycosylated polypeptide chain containing 260 amino acids (21-242 a.a) and having a molecular mass of 29.6kDa. IL34 is fused to a 38 amino acid His-tag at N-terminus & purified by proprietary chromatographic techniques.
Pureza:Min 85% By Sds-Page.Amyloid beta-Protein (25-35) amide
Catalogue peptide; min. 95% purity
Fórmula:C45H82N14O13SPeso molecular:1,059.31 g/molSubstance P reversed sequence
Catalogue peptide; min. 95% purity
Fórmula:C63H98N18O13SPeso molecular:1,347.66 g/molHypercalcemia Malignancy Factor (1-40)
Catalogue peptide; min. 95% purity
Fórmula:C180H287N57O48Peso molecular:4,017.55 g/molRef: 3D-VAC-00670
Producto descatalogadoAmyloid beta-Protein (6-20)
Catalogue peptide; min. 95% purity
Fórmula:C86H119N23O23Peso molecular:1,843.05 g/molTachykinin (111-129) Beta-Prepro (Human)
Catalogue peptide; min. 95% purity
Fórmula:C96H156N34O31SPeso molecular:2,314.59 g/molParallel topology beta-Amyloid modified peptide
Catalogue peptide; min. 95% purity
Fórmula:C151H211N37O39SPeso molecular:3,199.65 g/molProlactin Releasing Peptide (12-31), bovine
Catalogue peptide; min. 95% purity
Fórmula:C103H156N32O25Peso molecular:2,242.59 g/molBiotin-ACTH (1-39), human
Catalogue peptide; min. 95% purity
Fórmula:C217H322N58O60SPeso molecular:4,767.47 g/mol(D-Ala2)-GRF (1-29) amide (human)
CAS:Please enquire for more information about (D-Ala2)-GRF (1-29) amide (human) including the price, delivery time and more detailed product information at the technical inquiry form on this pageFórmula:C149H246N44O42SPureza:Min. 95%Peso molecular:3,357.88 g/molRef: 3D-FA109070
Producto descatalogadobeta-Interleukin II (44-56)
Catalogue peptide; min. 95% purity
Fórmula:C68H113N19O19Peso molecular:1,500.77 g/mol[Val5,Asn9]-Angiotensin I
Catalogue peptide; min. 95% purity
Fórmula:C59H86N16O15Peso molecular:1,259.44 g/molC-terminal Proghrelin Isoform Peptide, mouse
Catalogue peptide; min. 95% purity
Fórmula:C50H86N22O17Peso molecular:1,267.38 g/mol[Ala144]-PLP (139-151) A144-PLP(139-151)
Catalogue peptide; min. 95% purity
Fórmula:C64H99N19O17Peso molecular:1,406.62 g/mol[Ile34]-beta-Amyloid (25-34)
Catalogue peptide; min. 95% purity
Fórmula:C40H72N12O13Peso molecular:929.09 g/molbeta-Amyloid (10-35)
Catalogue peptide; min. 95% purity
Fórmula:C133H204N34O37SPeso molecular:2,903.38 g/molADP-Ribosylation Factor 6, ARF6 (2-13)
Catalogue peptide; min. 95% purity
Fórmula:C60H102N16O17Peso molecular:1,319.58 g/molH-Asp-NH2
CAS:H-Asp-NH2 is an isomeric mixture of l-phenylalanine and its methyl ester. It is used as a feed additive in animals to improve growth and feed conversion efficiency. The deamination of H-Asp-NH2 produces hydrogen peroxide, which has been shown to be lethal to enterobacteriaceae. This compound may also act as a microbial growth inhibitor by preventing the formation of peptides during synthesis.
Fórmula:C4H8N2O3Pureza:Min. 95%Peso molecular:132.12 g/molBiotin-Kinase Domain of Insulin Receptor (2)
Catalogue peptide; min. 95% purity
Fórmula:C72H122N21O29SPeso molecular:1,777.92 g/molZ-Ile-Glu(OtBu)-Ala-Leu-aldehyde
CAS:Z-Ile-Glu(OtBu)-Ala-Leu-aldehyde, also known as ZILEAL, is a potent immunosuppressant that binds to the Toll-like receptor (TLR) and inhibits NF-κB binding activity. It has been shown to reduce the activation of macrophages by inhibiting the production of proinflammatory cytokines such as tumor necrosis factor alpha (TNFα), IL-1β, and IL-6. This drug has been shown to inhibit HIV replication in vitro and was also found to have an antiviral effect against herpes simplex virus type 1 in vivo. ZILEAL also inhibits dsDNA binding activity, which may have potential applications in cancer treatment.
Fórmula:C32H50N4O8Pureza:Min. 95%Peso molecular:618.76 g/molRef: 3D-FI111570
Producto descatalogadoAdrenomedullin (1-52), porcine
Catalogue peptide; min. 95% purity
Fórmula:C262H403N79O76S3Peso molecular:5,971.67 g/molH-MFAMKTKAALAIWCPGYSETQINATQAMKKRRKRKVTTNKCLEQVSQLQGLWRRFNRPLLKQQ-OH
Peptide H-MFAMKTKAALAIWCPGYSETQINATQAMKKRRKRKVTTNKCLEQVSQLQGLWRRFNRPLLKQQ-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
KGF Receptor Peptide
Catalogue peptide; min. 95% purity
Fórmula:C114H174N30O42SPeso molecular:2,668.90 g/molAmyloid Bri Protein (1-34)
Catalogue peptide; min. 95% purity
Fórmula:C173H273N49O52S2Peso molecular:3,935.55 g/molα-Melanocyte Stimulating Hormone, acetylated-[D-Val13] (11-13) (MSHa)
Catalogue peptide; min. 95% purity
Fórmula:C18H33N5O4Peso molecular:383.49 g/molAdrenomedullin (1-52), human
Catalogue peptide; min. 95% purity
Fórmula:C264H406N80O77S3Peso molecular:6,028.72 g/molbeta-Amyloid (1-34)
Catalogue peptide; min. 95% purity
Fórmula:C170H253N47O52Peso molecular:3,787.20 g/molRef: 3D-VAC-00310
Producto descatalogadoα-Mating Factor (1-6)
Catalogue peptide; min. 95% purity
Fórmula:C45H59N11O8Peso molecular:882.04 g/molCorticotropin trifluoroacetate
Please enquire for more information about Corticotropin trifluoroacetate including the price, delivery time and more detailed product information at the technical inquiry form on this page
Pureza:Min. 95%Ref: 3D-BC183139
Producto descatalogadoP60c-src Substrate II, Phosphorylated
Catalogue peptide; min. 95% purity
Fórmula:C33H45N6O12PPeso molecular:748.8 g/mol[Met2]-Deltorphin
Catalogue peptide; min. 95% purity
Fórmula:C44H62N10O10S2Peso molecular:955.17 g/molSynaptobrevin-2 (75-78) (human, bovine, mouse, rat)
Catalogue peptide; min. 95% purity
Fórmula:C23H33N5O9Peso molecular:523.55 g/molFmoc-Asp(OtBu)-Wang resin (100-200 mesh)
Please enquire for more information about Fmoc-Asp(OtBu)-Wang resin (100-200 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page
Pureza:Min. 95%Ref: 3D-FF111724
Producto descatalogado[D-Tyr11]-Neurotensin
Catalogue peptide; min. 95% purity
Fórmula:C78H121N21O20Peso molecular:1,673 g/molBTK derived peptide
Catalogue peptide; min. 95% purity
Fórmula:C72H115N17O18S2Peso molecular:1,570.95 g/molDesmopressin
CAS:Producto controladoDesmopressin is a synthetic analog of the natural hormone arginine vasopressin. It has been shown to be effective in the treatment of primary nocturnal enuresis, and a number of studies have reported that desmopressin is an effective therapy for idiopathic nocturnal enuresis. Desmopressin also has effects on water permeability, hemolysis, and protein synthesis. It increases the concentration of camp levels in urine and plasma while also inhibiting erythrocyte aggregation. Desmopressin has been shown to be more effective than placebo in women with primary nocturnal enuresis.Fórmula:C46H64N14O12S2Pureza:Min. 95%Forma y color:PowderPeso molecular:1,069.22 g/molKinase Domain of Insulin Receptor (3)
Catalogue peptide; min. 95% purity
Fórmula:C72H108N19O27Peso molecular:1,702.77 g/molVasoactive Intestinal Contractor [VIC]
Catalogue peptide; min. 95% purity
Fórmula:C116H161N27O32S4Peso molecular:2,573.99 g/molH-D-Phe-pip-Arg-pna acetate
CAS:H-D-Phe-pip-Arg-pna acetate is an allosteric modulator that binds to the active site of thrombin. It inhibits activation of zymogen thrombin by binding to its receptor, thereby inhibiting clotting and coagulation. This compound has been shown to inhibit the activation of pyogenes by preventing the formation of fibrin clots, which are essential for bacterial growth. H-D-Phe-pip-Arg-pna acetate has also been shown to have an inhibitory effect on activated coagulation.
Fórmula:C27H36N8O5Pureza:Min. 95%Peso molecular:552.6 g/molBiotin-LC-Neurogranin (28-43)
Catalogue peptide; min. 95% purity
Fórmula:C94H159N31O20S2Peso molecular:2,139.48 g/molTryptophan Motif Peptide
Catalogue peptide; min. 95% purity
Fórmula:C35H41N11O7Peso molecular:727.79 g/molAngiotensin A (1-7) trifluoroacetate
CAS:Endogenous heptapetide which causes vasodilation and has anti-hypertensive properties.
Fórmula:C40H62N12O9•(C2HF3O2)xPureza:Min. 95%Forma y color:PowderPeso molecular:855 g/molH-ASCLYGQLPK-OH
Peptide H-ASCLYGQLPK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Fórmula:C48H76N12O13SPeso molecular:1,079.27 g/molCerebellin trifluoroacetate
CAS:Please enquire for more information about Cerebellin trifluoroacetate including the price, delivery time and more detailed product information at the technical inquiry form on this page
Fórmula:C69H113N23O23•(C2HF3O2)4Pureza:Min. 95%Peso molecular:2,088.86 g/molRef: 3D-BC184180
Producto descatalogadoH-GILGFVFTL-OH
CAS:FluM1 (58-66) is a short part of the matrix protein of Influenza A virus which is the most abundant component of this enveloped virus localized under the viral lipid envelope. The GILGFVFTL epitope is highly conserved in Influenza A virus strains at a rate of 93% for 69 strains tested. Human Influenza epitopes may bind MHC molecules and then may be recognized by CD8+ cytotoxic T cells. Applications of FluM1 (58-66): FluM1 (58-66) is used to stimulate CTL responses in peripheral blood mononuclear cells (PBMCs). Then, ELISPOT assay is used to quantify peptide epitope specificity and IFN-γ releasing effector cells. FluM1 (58-66) has shown CTL responses qualified of immunodominant with restriction by HLA-A*02:01. It has also been detected CTL responses when FluM1 (58-66) is restricted by all HLA-C. Therefore, FluM1 (58-66) may help to understand the reaction of immune system against Influenza virus of each populations having different HLA type. FluM1 (58-66) has indeed prompted research to develop T-cell vaccine strategies capable of inducing specific CTL responses in patients upon immunization with Influenza M1 antigenic epitope. MVA-NP+M1 vaccine use GILGFVFTL epitope and is tested in clinical trial. Potential cross-reactivity with HIV-1 p17 Gag (77-85): Moreover, FluM1 (58-66) share similarities with HIV-1 p17 Gag (77-85) which can potentially show a cross-reactivity between these epitopes. It has been demonstrated a cross-reactivity and results suggest that immunity following infection by Influenza virus causes specific immune response to HIV-1 p17 Gag (77-85).
Fórmula:C49H75N9O11Peso molecular:966.18 g/molCoibamide A
CAS:Please enquire for more information about Coibamide A including the price, delivery time and more detailed product information at the technical inquiry form on this page
Fórmula:C65H110N10O16Pureza:Min. 95%Peso molecular:1,287.65 g/mol
![[D-Tyr27,36, D-Thr32]-Neuropeptide Y, human](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00911.webp&w=3840&q=75)
![[Val5,Asn9]-Angiotensin I](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00346.webp&w=3840&q=75)
![[Ala144]-PLP (139-151) A144-PLP(139-151)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00493.webp&w=3840&q=75)
![[Ile34]-beta-Amyloid (25-34)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00451.webp&w=3840&q=75)
![α-Melanocyte Stimulating Hormone, acetylated-[D-Val13] (11-13) (MSHa)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00035.webp&w=3840&q=75)
![[Met2]-Deltorphin](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00898.webp&w=3840&q=75)
![[D-Tyr11]-Neurotensin](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00160.webp&w=3840&q=75)
![Vasoactive Intestinal Contractor [VIC]](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00288.webp&w=3840&q=75)
