Péptidos
Subcategorías de "Péptidos"
Se han encontrado 29599 productos de "Péptidos"
Biotin-a-CGRP (canine, mouse, rat)
Catalogue peptide; min. 95% purity
Fórmula:C172H276N52O54S3Peso molecular:4,032.63 g/mol[Val5,Asn9]-Angiotensin I
Catalogue peptide; min. 95% purity
Fórmula:C59H86N16O15Peso molecular:1,259.44 g/molDynorphin A (2-12), porcine
Catalogue peptide; min. 95% purity
Fórmula:C60H105N21O12Peso molecular:1,312.64 g/molDynorphin A (3-8), porcine
Catalogue peptide; min. 95% purity
Fórmula:C35H60N12O7Peso molecular:760.94 g/molFmoc-Asp(OtBu)-Wang resin (100-200 mesh)
Please enquire for more information about Fmoc-Asp(OtBu)-Wang resin (100-200 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page
Pureza:Min. 95%Ref: 3D-FF111724
Producto descatalogado[Arg0] Met-Enkephalin
Catalogue peptide; min. 95% purity
Fórmula:C33H47N9O8SPeso molecular:729.86 g/mol[Phe1376]-Fibronectin Fragment (1371-1382)
Catalogue peptide; min. 95% purity
Fórmula:C63H103N25O19Peso molecular:1,514.68 g/molRef: 3D-VAC-00670
Producto descatalogadoZ-Gly-Gly-Trp-OH TFA
CAS:Please enquire for more information about Z-Gly-Gly-Trp-OH TFA including the price, delivery time and more detailed product information at the technical inquiry form on this page
Fórmula:C23H24N4O6•C2HF3O2Pureza:Min. 95%Peso molecular:566.48 g/molRef: 3D-FG111473
Producto descatalogadoDesmopressin
CAS:Producto controladoDesmopressin is a synthetic analog of the natural hormone arginine vasopressin. It has been shown to be effective in the treatment of primary nocturnal enuresis, and a number of studies have reported that desmopressin is an effective therapy for idiopathic nocturnal enuresis. Desmopressin also has effects on water permeability, hemolysis, and protein synthesis. It increases the concentration of camp levels in urine and plasma while also inhibiting erythrocyte aggregation. Desmopressin has been shown to be more effective than placebo in women with primary nocturnal enuresis.Fórmula:C46H64N14O12S2Pureza:Min. 95%Forma y color:PowderPeso molecular:1,069.22 g/mol[Trp11] Neurotensin (8-13)
Catalogue peptide; min. 95% purity
Fórmula:C40H65N13O7Peso molecular:840.05 g/molRef: 3D-VAC-00688
Producto descatalogadoC-terminal Proghrelin Isoform Peptide, mouse
Catalogue peptide; min. 95% purity
Fórmula:C50H86N22O17Peso molecular:1,267.38 g/molH-Asp-NH2
CAS:H-Asp-NH2 is an isomeric mixture of l-phenylalanine and its methyl ester. It is used as a feed additive in animals to improve growth and feed conversion efficiency. The deamination of H-Asp-NH2 produces hydrogen peroxide, which has been shown to be lethal to enterobacteriaceae. This compound may also act as a microbial growth inhibitor by preventing the formation of peptides during synthesis.
Fórmula:C4H8N2O3Pureza:Min. 95%Peso molecular:132.12 g/mol[Ala5, beta-Ala8]-Neurokinin A (4-10)
Catalogue peptide; min. 95% purity
Fórmula:C35H56N8O9SPeso molecular:765 g/molRef: 3D-VAC-00317
Producto descatalogadoZ-Ile-Trp-OH
CAS:Please enquire for more information about Z-Ile-Trp-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page
Fórmula:C25H29N3O5Pureza:Min. 95%Peso molecular:451.51 g/molRef: 3D-FI111493
Producto descatalogadoN-(3-Amino-2-hydroxy-3-oxopropyl)-L-valyl-N-phenyl-L-leucinamide
CAS:Please enquire for more information about N-(3-Amino-2-hydroxy-3-oxopropyl)-L-valyl-N-phenyl-L-leucinamide including the price, delivery time and more detailed product information at the technical inquiry form on this pageFórmula:C20H32N4O4Pureza:Min. 95%Forma y color:PowderPeso molecular:392.49 g/molKetolide resistance Peptide MRFFV
Catalogue peptide; min. 95% purity
Fórmula:C34H50N8O6SPeso molecular:698.9 g/molH-Thr-Asp-OH TFA salt
CAS:Please enquire for more information about H-Thr-Asp-OH TFA salt including the price, delivery time and more detailed product information at the technical inquiry form on this page
Fórmula:C8H14N2O6C2F3HO2Pureza:Min. 95%Peso molecular:348.23 g/molRef: 3D-FT108183
Producto descatalogadoBiotin-[Tyr0]-Orexin B, mouse, rat
Catalogue peptide; min. 95% purity
Fórmula:C145H238N48O38S2Peso molecular:3,325.86 g/molbeta-Amyloid (8-38)
Catalogue peptide; min. 95% purity
Fórmula:C147H227N39O43SPeso molecular:3,260.75 g/molBoc-D-Glu-OEt·DCHA
CAS:Producto controladoPlease enquire for more information about Boc-D-Glu-OEt·DCHA including the price, delivery time and more detailed product information at the technical inquiry form on this page
Fórmula:C12H21NO6·C12H23NPureza:Min. 95%Peso molecular:456.62 g/molRef: 3D-FB111281
Producto descatalogadoGrowth Hormone Releasing Factor, GRF (1-40), amide, human
Catalogue peptide; min. 95% purity
Fórmula:C194H318N62O62SPeso molecular:4,543.14 g/molBCIP dipotassium
CAS:BCIP (5-bromo-4-chloro-3-indolyl phosphate) dipotassium is a chromogenic substrate commonly used for the detection of the enzymatic activity of alkaline phosphatase. Upon dephosphorylation by alkaline phosphatase, BCIP produces a blue precipitate, which can be easily visualized. This substrate has various uses, including the detection of gene expression in molecular biology, the identification of alkaline phosphatase activity in clinical pathology, and the detection of protein-protein interactions in biochemistry. Its long-term stability in solution makes it a common choice for many applications.
Fórmula:C8H4BrClK2NO4PPureza:Min. 98 Area-%Forma y color:PowderPeso molecular:402.65 g/molRef: 3D-EB110885
Producto descatalogado[Gln22]-25359-Amyloid (6-40)
Catalogue peptide; min. 95% purity
Fórmula:C167H258N46O48SPeso molecular:3,710.26 g/molbeta-Amyloid (17-40)
Catalogue peptide; min. 95% purity
Fórmula:C110H178N26O31SPeso molecular:2,392.86 g/molRef: 3D-VAC-00589
Producto descatalogadoBoc-D-His(Boc)-OH benzene solvate
CAS:Please enquire for more information about Boc-D-His(Boc)-OH benzene solvate including the price, delivery time and more detailed product information at the technical inquiry form on this page
Fórmula:C16H25N3O6Pureza:Min. 95%Forma y color:SolidPeso molecular:355.39 g/molRef: 3D-FB111250
Producto descatalogado[Thr46]-Osteocalcin (45-49) (human)
Catalogue peptide; min. 95% purity
Fórmula:C25H37N5O7Peso molecular:519.6 g/mol[Ala8]-Humanin, [Ala8]-HN, Shna
Catalogue peptide; min. 95% purity
Fórmula:C119H204N34O32SPeso molecular:2,655.23 g/molbeta-Amyloid (1-34)
Catalogue peptide; min. 95% purity
Fórmula:C170H253N47O52Peso molecular:3,787.20 g/molRef: 3D-VAC-00310
Producto descatalogadoBiotin-Kinase Domain of Insulin Receptor (2)
Catalogue peptide; min. 95% purity
Fórmula:C72H122N21O29SPeso molecular:1,777.92 g/molCorticostatin, human
Catalogue peptide; min. 95% purity
Fórmula:C157H261N49O43S6Peso molecular:3,715.47 g/molAllatostatin I (free acid)
Catalogue peptide; min. 95% purity
Fórmula:C61H94N18O16Peso molecular:1,335.5 g/molBiotin-Gastrin Releasing Peptide, human
Catalogue peptide; min. 95% purity
Fórmula:C140H218N40O33S3Peso molecular:3,085.74 g/molBTK derived peptide
Catalogue peptide; min. 95% purity
Fórmula:C72H115N17O18S2Peso molecular:1,570.95 g/mol[Tyr27]-a-CGRP (27-37) (canine, mouse, rat)
Catalogue peptide; min. 95% purity
Fórmula:C54H79N13O17Peso molecular:1,182.31 g/mol[Asn76] PTH (64-84), human
Catalogue peptide; min. 95% purity
Fórmula:C94H163N27O35Peso molecular:2,231.51 g/molHuman CMV Assemblin Protease Substrate (M-site)
Catalogue peptide; min. 95% purity
Fórmula:C52H96N20O16Peso molecular:1,257.47 g/molPre-S1 (12-32)
Catalogue peptide; min. 95% purity
Fórmula:C104H154N26O31SPeso molecular:2,296.61 g/molbeta-Interleukin II (44-56)
Catalogue peptide; min. 95% purity
Fórmula:C68H113N19O19Peso molecular:1,500.77 g/mol[Arg3] Substance P
Catalogue peptide; min. 95% purity
Fórmula:C63H98N20O13SPeso molecular:1,375.67 g/molRef: 3D-VAC-00678
Producto descatalogadoBoc-Lys(Tfa)-AMC
CAS:Boc-Lys(Tfa)-AMC is a small molecule that inhibits the acetylation of histone H3 and has anticancer activity. Acetylation increases the rate of transcription and replication, whereas Boc-Lys(Tfa)-AMC inhibits this process by preventing acetylation. This drug also binds to δ-opioid receptors in cancer cells, triggering a redox signal that leads to inhibition of cancer cell proliferation. The mechanism of this drug's anticancer activity is unknown, but it may be due to its ability to inhibit enzyme activities or disulfide bond formation in vivo.
Fórmula:C23H28F3N3O6Pureza:Min. 95%Peso molecular:499.48 g/molRef: 3D-FB110609
Producto descatalogadoα-Conotoxin IMI
Catalogue peptide; min. 95% purity
Fórmula:C52H74N20O15S4Peso molecular:1,347.58 g/mol[Pyr6]-Substance P (6-11)
Catalogue peptide; min. 95% purity
Fórmula:C36H49N7O7SPeso molecular:723.91 g/molα-Bag Cell Peptide (1-7)
Catalogue peptide; min. 95% purity
Fórmula:C44H67N13O9Peso molecular:922.11 g/molPKA Inhibitor Substrate
Catalogue peptide; min. 95% purity
Fórmula:C61H108N25O22PPeso molecular:1,574.69 g/molgp100 (178-187)
Catalogue peptide; min. 95% purity
Fórmula:C42H71N11O14S2Peso molecular:1,018.23 g/molbeta-Amyloid (1-11)
Catalogue peptide; min. 95% purity
Fórmula:C56H76N16O22Peso molecular:1,325.32 g/molCC Chemokine Receptor 3 Fragment II, amide
Catalogue peptide; min. 95% purity
Fórmula:C114H175N25O42S2Peso molecular:2,631.93 g/mol[Tyr1]-pTH (1-34) (rat)
Catalogue peptide; min. 95% purity
Fórmula:C186H295N55O49S2Peso molecular:4,149.86 g/molPalmitoyl-Cys((RS)-2,3-di(palmitoyloxy)-propyl)-OH
CAS:Palmitoyl-Cys((RS)-2,3-di(palmitoyloxy)-propyl)-OH is a synthetic cytochalasin that has been shown to have bactericidal activity against Gram-positive bacteria. It inhibits the growth of bacteria by binding to extracellular anions, such as diacylglycerol and aluminium ions. Palmitoyl-Cys((RS)-2,3-di(palmitoyloxy)-propyl)-OH also synergizes with phorbol esters and lipoprotein. This drug has been shown to be effective in treating human serum infections at doses of 100 µg/mL and higher.
Fórmula:C54H103NO7SPureza:Min. 95%Peso molecular:910.46 g/molRef: 3D-FP107899
Producto descatalogadoParallel topology beta-Amyloid modified peptide
Catalogue peptide; min. 95% purity
Fórmula:C151H211N37O39SPeso molecular:3,199.65 g/molFluorescein-6-carbonyl-Ile-Glu(OMe)-Thr-DL-Asp(OMe)-fluoromethylketone
CAS:Please enquire for more information about Fluorescein-6-carbonyl-Ile-Glu(OMe)-Thr-DL-Asp(OMe)-fluoromethylketone including the price, delivery time and more detailed product information at the technical inquiry form on this page
Fórmula:C43H47FN4O15Pureza:Min. 95%Peso molecular:878.85 g/molRef: 3D-FF111109
Producto descatalogadoDisulfide biotin azide
CAS:Extraordinary strength of the streptavidin-biotin interaction allows for efficient capturing of even highly dilute targets; however, it makes recovery of proteins from affinity resins challenging. Conventional methods to elute biotinylated proteins from immobilized avidin include the following: (i) denaturation of streptavidin by boiling the resin in a denaturing buffer that may include high concentrations of chaotropic salts, (ii) trypsin digestion of proteins while they are bound to the resin, or (iii) elution of proteins with excess free biotin. These protocols can co-elute contaminant proteins by releasing nonspecifically bound proteins and/or naturally biotinylated proteins concurrently with labeled proteins. In addition, some of these methods can cause elution of high levels of resin-based peptides along with the proteins of interest, resulting in further sample contamination.
Disulfide Biotin Azide probe eliminates a major limitation of the streptavidin-biotin affinity purification. This reagent contains a biotin moiety linked to an azide moiety through a spacer arm containing a cleavable disulfide linker. Captured biomolecules can be efficiently released under mild conditions (50 mM dithiothreitol, 10 mM 2-mercaptoethanol or 1% sodium borohydride) and the small molecular fragment (188.25 Da) left on the labeled protein following cleavage. These features make the cleavable probe especially attractive for use in biomolecular labeling and proteomic studies.Fórmula:C27H48N8O7S3Pureza:Min 95%Peso molecular:692.92 g/molAngiotensin II Substrate
Catalogue peptide; min. 95% purity
Fórmula:C50H72N13O15PPeso molecular:1,126.20 g/mol(Deamino-Phe19,D-Ala24,D-Pro26-psi(CH2NH)Phe27)-GRP (19-27) (human, porcine, canine) trifluoroacetate salt
CAS:Please enquire for more information about (Deamino-Phe19,D-Ala24,D-Pro26-psi(CH2NH)Phe27)-GRP (19-27) (human, porcine, canine) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page
Fórmula:C57H72N14O8Pureza:Min. 95%Peso molecular:1,081.27 g/molRef: 3D-FD108769
Producto descatalogadoZ-Ile-Glu(OtBu)-Ala-Leu-aldehyde
CAS:Z-Ile-Glu(OtBu)-Ala-Leu-aldehyde, also known as ZILEAL, is a potent immunosuppressant that binds to the Toll-like receptor (TLR) and inhibits NF-κB binding activity. It has been shown to reduce the activation of macrophages by inhibiting the production of proinflammatory cytokines such as tumor necrosis factor alpha (TNFα), IL-1β, and IL-6. This drug has been shown to inhibit HIV replication in vitro and was also found to have an antiviral effect against herpes simplex virus type 1 in vivo. ZILEAL also inhibits dsDNA binding activity, which may have potential applications in cancer treatment.
Fórmula:C32H50N4O8Pureza:Min. 95%Peso molecular:618.76 g/molRef: 3D-FI111570
Producto descatalogadoBiotin-Neurokinin B
Catalogue peptide; min. 95% purity
Fórmula:C67H87N15O14Peso molecular:1,326.53 g/molCys-Gly-Lys-Lys-Gly-Amyloid beta-Protein (36-42)
Catalogue peptide; min. 95% purity
Fórmula:C47H85N14O13SPeso molecular:1,087.35 g/mol[Ala144]-PLP (139-151) A144-PLP(139-151)
Catalogue peptide; min. 95% purity
Fórmula:C64H99N19O17Peso molecular:1,406.62 g/molP69 (522-534), M. leprae
Catalogue peptide; min. 95% purity
Fórmula:C52H84N14O21Peso molecular:1,241.33 g/molFas C-Terminal Tripeptide
Catalogue peptide; min. 95% purity
Fórmula:C16H29N3O6Peso molecular:359.43 g/molBiotin-Galanin, human
Catalogue peptide; min. 95% purity
Fórmula:C149H224N44O45SPeso molecular:3,383.78 g/molp3K truncated, (Lys 58 Lys 60 Lys 63) Ea(54-68)
Catalogue peptide; min. 95% purity
Fórmula:C59H97N17O19Peso molecular:1,348.53 g/molRnase (90-105)
H-SKYPNCAYKTTQANKH-OH peptide, corresponding to RNase A 90-105 (Chain A of bovine pancreatic ribonuclease); min. 95% purity
Fórmula:C80H124N24O25SPeso molecular:1,854.08 g/molIntermedin (human)
Catalogue peptide; min. 95% purity
Fórmula:C219H351N69O66S3Peso molecular:5,102.84 g/molPannexin-1 Fragment (4515)
Catalogue peptide; min. 95% purity
Fórmula:C59H104N22O20Peso molecular:1,441.62 g/mol[D-Pro194]-IL-1 beta (193-195) (human)
Catalogue peptide; min. 95% purity
Fórmula:C15H28N4O5Peso molecular:344.41 g/molH-MFAMKTKAALAIWCPGYSETQINATQAMKKRRKRKVTTNKCLEQVSQLQGLWRRFNRPLLKQQ-OH
Peptide H-MFAMKTKAALAIWCPGYSETQINATQAMKKRRKRKVTTNKCLEQVSQLQGLWRRFNRPLLKQQ-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Calcitonin (8-32) (salmon I)
Catalogue peptide; min. 95% purity
Fórmula:C119H198N36O37Peso molecular:2,725.06 g/molAntioxidant peptide A
Catalogue peptide; min. 95% purity
Fórmula:C31H54N12O7S2Peso molecular:770.97 g/mol[D-Pro4,D-Trp7,9,Nle11]-Substance P (4-11)
Catalogue peptide; min. 95% purity
Fórmula:C58H77N13O10Peso molecular:1,116.34 g/molIntermedin (rat)
Catalogue peptide; min. 95% purity
Fórmula:C226H361N75O64S2Peso molecular:5,216.99 g/molAmyloid Bri Protein (1-34)
Catalogue peptide; min. 95% purity
Fórmula:C173H273N49O52S2Peso molecular:3,935.55 g/molCecropin A (1-7)-Melittin A (2-9) amide
Catalogue peptide; min. 95% purity
Fórmula:C89H152N22O15Peso molecular:1,770.34 g/molBiotin-Angiotensin I, human
Catalogue peptide; min. 95% purity
Fórmula:C72H103N19O16SPeso molecular:1,522.81 g/molH-ASCLYGQLPK-OH
Peptide H-ASCLYGQLPK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Fórmula:C48H76N12O13SPeso molecular:1,079.27 g/molAngiotensin A (1-7) trifluoroacetate
CAS:Endogenous heptapetide which causes vasodilation and has anti-hypertensive properties.
Fórmula:C40H62N12O9•(C2HF3O2)xPureza:Min. 95%Forma y color:PowderPeso molecular:855 g/molCerebellin trifluoroacetate
CAS:Please enquire for more information about Cerebellin trifluoroacetate including the price, delivery time and more detailed product information at the technical inquiry form on this page
Fórmula:C69H113N23O23•(C2HF3O2)4Pureza:Min. 95%Peso molecular:2,088.86 g/molRef: 3D-BC184180
Producto descatalogadoH-GILGFVFTL-OH
CAS:FluM1 (58-66) is a short part of the matrix protein of Influenza A virus which is the most abundant component of this enveloped virus localized under the viral lipid envelope. The GILGFVFTL epitope is highly conserved in Influenza A virus strains at a rate of 93% for 69 strains tested. Human Influenza epitopes may bind MHC molecules and then may be recognized by CD8+ cytotoxic T cells. Applications of FluM1 (58-66): FluM1 (58-66) is used to stimulate CTL responses in peripheral blood mononuclear cells (PBMCs). Then, ELISPOT assay is used to quantify peptide epitope specificity and IFN-γ releasing effector cells. FluM1 (58-66) has shown CTL responses qualified of immunodominant with restriction by HLA-A*02:01. It has also been detected CTL responses when FluM1 (58-66) is restricted by all HLA-C. Therefore, FluM1 (58-66) may help to understand the reaction of immune system against Influenza virus of each populations having different HLA type. FluM1 (58-66) has indeed prompted research to develop T-cell vaccine strategies capable of inducing specific CTL responses in patients upon immunization with Influenza M1 antigenic epitope. MVA-NP+M1 vaccine use GILGFVFTL epitope and is tested in clinical trial. Potential cross-reactivity with HIV-1 p17 Gag (77-85): Moreover, FluM1 (58-66) share similarities with HIV-1 p17 Gag (77-85) which can potentially show a cross-reactivity between these epitopes. It has been demonstrated a cross-reactivity and results suggest that immunity following infection by Influenza virus causes specific immune response to HIV-1 p17 Gag (77-85).
Fórmula:C49H75N9O11Peso molecular:966.18 g/molCoibamide A
CAS:Please enquire for more information about Coibamide A including the price, delivery time and more detailed product information at the technical inquiry form on this page
Fórmula:C65H110N10O16Pureza:Min. 95%Peso molecular:1,287.65 g/mol
![[Val5,Asn9]-Angiotensin I](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00346.webp&w=3840&q=75)
![[Arg0] Met-Enkephalin](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00699.webp&w=3840&q=75)
![[Phe1376]-Fibronectin Fragment (1371-1382)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00679.webp&w=3840&q=75)
![[Trp11] Neurotensin (8-13)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00688.webp&w=3840&q=75)
![[Cit5]-TRAP-5](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00717.webp&w=3840&q=75)
![[Ala5, beta-Ala8]-Neurokinin A (4-10)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00317.webp&w=3840&q=75)
![Biotin-[Tyr0]-Orexin B, mouse, rat](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00130.webp&w=3840&q=75)
![[Gln22]-25359-Amyloid (6-40)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00470.webp&w=3840&q=75)
![[Thr46]-Osteocalcin (45-49) (human)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00401.webp&w=3840&q=75)
![[Ala8]-Humanin, [Ala8]-HN, Shna](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00593.webp&w=3840&q=75)
![[Tyr27]-a-CGRP (27-37) (canine, mouse, rat)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00929.webp&w=3840&q=75)
![[Asn76] PTH (64-84), human](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00372.webp&w=3840&q=75)
![[Arg3] Substance P](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00678.webp&w=3840&q=75)
![[Pyr6]-Substance P (6-11)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00172.webp&w=3840&q=75)
![[Tyr1]-pTH (1-34) (rat)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00930.webp&w=3840&q=75)
![[Ala144]-PLP (139-151) A144-PLP(139-151)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00493.webp&w=3840&q=75)
![[D-Pro194]-IL-1 beta (193-195) (human)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00516.webp&w=3840&q=75)
![[D-Pro4,D-Trp7,9,Nle11]-Substance P (4-11)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00148.webp&w=3840&q=75)
