Produits biochimiques et réactifs

<p>PTH antibody was raised in rabbit using human glandular PTH as the immunogen.</p>

<p>The HIV1 gp41 protein is a target for inhibitors in the treatment of HIV/AIDS. It plays a crucial role in viral entry into host cells by mediating fusion between the viral and cellular membranes. Inhibiting this protein can prevent viral replication and spread.</p>

<p>Estradiol-6 antibody was raised in rabbit using 17 beta-Estradiol-6-BSA as the immunogen.</p>

<p>Gastrin antibody was raised in rabbit using human gastrin as the immunogen.</p>

<p>The CD4 protein is a glycoprotein that plays a crucial role in the immune system. It is primarily found on the surface of helper T cells, which are a type of white blood cell involved in coordinating immune responses. The CD4 protein acts as a receptor for the HIV virus, allowing it to enter and infect host cells.</p>

<p>FITC antibody was raised in rabbit using fluorescein isothiocyanate-KLH as the immunogen.</p>

<p>Goat anti rabbit IgG was raised in goat using highly purified rabbit IgG as the immunogen.</p>

<p>NSE antibody was raised in mouse using NSE from the human brain as the immunogen.</p>

<p>HIV1 gp120 antibody was raised in rabbit using full length recombinant gp120 (HIV-1) as the immunogen.</p>

<p>Purified recombinant HIV1 vif IIIB protein</p>

<p>Streptococcus group A antibody was raised in goat using group A Streptococci as the immunogen.</p>

<p>Mouse monoclonal HIV2 gp105 antibody (biotin)</p>

<p>Cianopramine is a potent, selective inhibitor of the uptake of 5-hydroxytryptamine (5-HT) at 5-HT2 receptors. It has been shown to be effective in vivo models for chronic schizophrenia and has shown promising results in clinical trials with drug-naive patients. Cianopramine also inhibits the binding of drugs such as clomipramine and other tricyclic antidepressants to their receptor sites. In addition, cianopramine is a bicyclic heterocycle that binds to the human serum albumin with high affinity and specificity.</p>

<p>Rabbit polyclonal HIV-1 Rev antibody</p>

<p>Purified recombinant HIV2 gp36 ROD (FITC)</p>

<p>FABP antibody was raised in goat using human fatty acid binding protein as the immunogen.</p>

<p>The Ebola Virus antibody is a highly specialized product in the field of Life Sciences. It is a monoclonal antibody that specifically targets the glycoprotein found on the surface of the Ebola virus. This antibody has been extensively studied and proven to be effective in neutralizing the virus by inhibiting its entry into host cells.</p>

<p>Purified recombinant HIV2 gp36 ROD (HRP)</p>

<p>THC antibody was raised in goat using delta-6-Tetrahydrocannabinol-KLH as the immunogen.</p>

<p>HIV1 rev antibody (FITC) was raised in rabbit using full length recombinant rev (HIV-1, HxB2, HxB3) produced in E. coli expression system as the immunogen.</p>

<p>Peptide H-RINSAKDDAAGLQIA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-DGRGDS-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-DRFYKTLRAEQASQEV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-KLQVFLIVL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>TAPI-1 is an inhibitor of TACE (TNF-α converting enzyme, also known as ADAM17) and matrix metalloproteinases (MMPs). It blocks the shedding of several cell surface proteins, including tumor necrosis factor-alpha (TNF-α), IL-6 receptor, and TNF receptors p60 (TNFRI) and p80 (TNFRII).</p>

<p>Peptide H-WHWLQLKPGQPMY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-WHWLQLKPGQPMY-OH include the following: Position one analogs of the Saccharomyces cerevisiae tridecapeptide pheromone YL Zhang, HUIFEN LU, JM Becker - The Journal of peptide , 1997 - Wiley Online Library<a href="https://onlinelibrary.wiley.com/doi/abs/10.1111/j.1399-3011.1997.tb01190.x" target="_blank" rel="noreferrer noopener">https://onlinelibrary.wiley.com/doi/abs/10.1111/j.1399-3011.1997.tb01190.x</a> Synthesis, Biological Activity, and Conformational Analysis of Peptidomimetic Analogues of the Saccharomyces cerevisiae alpha-Factor Tridecapeptide YL Zhang, HR Marepalli, H Lu, JM Becker - Biochemistry, 1998 - ACS Publications<a href="https://pubs.acs.org/doi/abs/10.1021/bi980787u" target="_blank" rel="noreferrer noopener">https://pubs.acs.org/doi/abs/10.1021/bi980787u</a> Receptor in Saccharomyces cereuisiae SK RathsSQ, M BeckerSII - researchgate.net<a href="https://www.researchgate.net/profile/Jeffrey-Becker-2/publication/20308809_Peptide_analogs_compete_with_binding_of_-factor_to_its_receptor_in_Saccharomyces_cerevisiae/links/09e415111549c85414000000/Peptide-analogs-compete-with-binding-of-factor-to-its-receptor-in-Saccharomyces-cerevisiae.pdf" target="_blank" rel="noreferrer noopener">https://www.researchgate.net/profile/Jeffrey-Becker-2/publication/20308809_Peptide_analogs_compete_with_binding_of_-factor_to_its_receptor_in_Saccharomyces_cerevisiae/links/09e415111549c85414000000/Peptide-analogs-compete-with-binding-of-factor-to-its-receptor-in-Saccharomyces-cerevisiae.pdf</a> Peptide analogues compete with the binding of alpha-factor to its receptor in Saccharomyces cerevisiae. SK Raths, F Naider, JM Becker - Journal of Biological Chemistry, 1988 - Elsevier<a href="https://www.sciencedirect.com/science/article/pii/S0021925819778405" target="_blank" rel="noreferrer noopener">https://www.sciencedirect.com/science/article/pii/S0021925819778405</a> Binding of fluorinated phenylalanine alpha-factor analogues to ste2p: Evidence for a cation-Ï€ binding interaction between a peptide ligand and its cognate G protein S Tantry, FX Ding, M Dumont , JM Becker, F Naider - Biochemistry, 2010 - ACS Publications<a href="https://pubs.acs.org/doi/abs/10.1021/bi100280f" target="_blank" rel="noreferrer noopener">https://pubs.acs.org/doi/abs/10.1021/bi100280f</a> Position 13 analogs of the tridecapeptide mating pheromone from Saccharomyces cerevisiae: design of an iodinatable ligand for receptor binding S Liu, B Arshava, F Naider, LK Henry - Journal of Peptide , 2000 - Wiley Online Library<a href="https://onlinelibrary.wiley.com/doi/abs/10.1034/j.1399-3011.2000.00730.x" target="_blank" rel="noreferrer noopener">https://onlinelibrary.wiley.com/doi/abs/10.1034/j.1399-3011.2000.00730.x</a> Ab initio calculations on Pro-Ala and Pro-Gly dipeptides O Antohi, F Naider, AM Sapse - Journal of Molecular Structure , 1996 - Elsevier<a href="https://www.sciencedirect.com/science/article/pii/0166128095043608" target="_blank" rel="noreferrer noopener">https://www.sciencedirect.com/science/article/pii/0166128095043608</a> Structural requirement tryptophan1,3 of tridecapeptide mating pheromone of Saccharomyces cerevisiae NJ Hong, YA Park, JW Lee - : Proceedings of the 1st International Peptide , 2002 - Springer<a href="https://link.springer.com/content/pdf/10.1007/0-306-46864-6_157.pdf" target="_blank" rel="noreferrer noopener">https://link.springer.com/content/pdf/10.1007/0-306-46864-6_157.pdf</a> Studies on conformational consequences of i to i+ 3 side-chain cyclization in model cyclic tetrapeptides MH RAO, WEI YANG, H JOSHUA - Journal of Peptide , 1995 - Wiley Online Library<a href="https://onlinelibrary.wiley.com/doi/abs/10.1111/j.1399-3011.1995.tb01057.x" target="_blank" rel="noreferrer noopener">https://onlinelibrary.wiley.com/doi/abs/10.1111/j.1399-3011.1995.tb01057.x</a> Specificity characterization of the alpha-mating factor hormone by Kex2 protease MA Manfredi, AA Antunes, LOP Jesus, MA Juliano - Biochimie, 2016 - Elsevier<a href="https://www.sciencedirect.com/science/article/pii/S0300908416302358" target="_blank" rel="noreferrer noopener">https://www.sciencedirect.com/science/article/pii/S0300908416302358</a> Control of the yeast cell cycle with a photocleavable alpha-factor analogue LL Parker , JW Kurutz, SBH Kent - Chemie (International ed , 2006 - ncbi.nlm.nih.gov<a href="https://www.ncbi.nlm.nih.gov/pmc/articles/PMC2788609/" target="_blank" rel="noreferrer noopener">https://www.ncbi.nlm.nih.gov/pmc/articles/PMC2788609/</a> Matrix-assisted laser desorption/ionization mass spectrometry peptide sequencing utilizing selective N-terminal bromoacetylation J Song, HJ Kim - Analytical biochemistry, 2012 - Elsevier<a href="https://www.sciencedirect.com/science/article/pii/S0003269711007548" target="_blank" rel="noreferrer noopener">https://www.sciencedirect.com/science/article/pii/S0003269711007548</a> Solution Structures of i to i + 3 Cyclized Model Peptides: Building Blocks Mimicking Specific Conformations HR Marepalli, O Antohi, JM Becker - Journal of the American , 1996 - ACS Publications<a href="https://pubs.acs.org/doi/abs/10.1021/ja954217i" target="_blank" rel="noreferrer noopener">https://pubs.acs.org/doi/abs/10.1021/ja954217i</a> Highly active analogs of alpha-factor and their activities against Saccharomyces cerevisiae HJ Ahn, EY Hong, DH Jin, NJ Hong - Bulletin of the Korean Chemical , 2014 - Citeseer<a href="https://citeseerx.ist.psu.edu/document?repid=rep1&amp;type=pdf&amp;doi=509ee315e2cbcb9fac108f48dfb1fa89d076f1b2" target="_blank" rel="noreferrer noopener">https://citeseerx.ist.psu.edu/document?repid=rep1&amp;type=pdf&amp;doi=509ee315e2cbcb9fac108f48dfb1fa89d076f1b2</a> Identification of residue-to-residue contact between a peptide ligand and its G protein-coupled receptor using periodate-mediated dihydroxyphenylalanine cross GKE Umanah, L Huang , F Ding, B Arshava - Journal of biological , 2010 - ASBMB<a href="https://www.jbc.org/article/S0021-9258(20)60639-1/abstract" target="_blank" rel="noreferrer noopener">https://www.jbc.org/article/S0021-9258(20)60639-1/abstract</a> Cross-linking of a DOPA-containing peptide ligand into its G protein-coupled receptor GKE Umanah, C Son , FX Ding, F Naider - Biochemistry, 2009 - ACS Publications<a href="https://pubs.acs.org/doi/abs/10.1021/bi802061z" target="_blank" rel="noreferrer noopener">https://pubs.acs.org/doi/abs/10.1021/bi802061z</a> Structural requirements for alpha-mating factor activity G Houen, O Nielsen, C Flanagan - FEBS letters, 1996 - Elsevier<a href="https://www.sciencedirect.com/science/article/pii/0014579396007260" target="_blank" rel="noreferrer noopener">https://www.sciencedirect.com/science/article/pii/0014579396007260</a> The alpha-factor mating pheromone of Saccharomyces cerevisiae: a model for studying the interaction of peptide hormones and G protein-coupled receptors F Naider, JM Becker - Peptides, 2004 - Elsevier<a href="https://www.sciencedirect.com/science/article/pii/S0196978104002943" target="_blank" rel="noreferrer noopener">https://www.sciencedirect.com/science/article/pii/S0196978104002943</a> Studies on the yeast alpha-mating factor: A model for mammalian peptide hormones F Naider, J Gounarides, CB Xue - Biopolymers , 1992 - Wiley Online Library<a href="https://onlinelibrary.wiley.com/doi/abs/10.1002/bip.360320407" target="_blank" rel="noreferrer noopener">https://onlinelibrary.wiley.com/doi/abs/10.1002/bip.360320407</a> Probing the Binding Site of a Heptahelical Peptide Pheromone Receptor Using Photoaffinity Labelling, Site-Directed Mutagenesis and Spectroscopic Approaches F Naider, BK Lee, LK Henry, F Ding, SK Khare - Peptides: The Wave of , 2001 - Springer<a href="https://link.springer.com/chapter/10.1007/978-94-010-0464-0_409" target="_blank" rel="noreferrer noopener">https://link.springer.com/chapter/10.1007/978-94-010-0464-0_409</a> Biophysical studies on a transmembrane peptide of the Saccharomyces cerevisiae alpha-factor receptor F Naider, B Arshava, H Xie, S Liu, WY Eng - Peptides for the New , 2002 - Springer<a href="https://link.springer.com/content/pdf/10.1007/0-306-46881-6_151.pdf" target="_blank" rel="noreferrer noopener">https://link.springer.com/content/pdf/10.1007/0-306-46881-6_151.pdf</a> Characterization of novel peptide agonists of the alpha mating factor of Saccharomyces cerevisiae EG Siegel, R Gunther, H Schafer, UR Fölsch - Analytical , 1999 - Elsevier<a href="https://www.sciencedirect.com/science/article/pii/S0003269799942896" target="_blank" rel="noreferrer noopener">https://www.sciencedirect.com/science/article/pii/S0003269799942896</a> Antagonistic and synergistic peptide analogs of the tridecapeptide mating pheromone of Saccharomyces cerevisiae E Eriotou-Bargiota , CB Xue, F Naider, JM Becker - Biochemistry, 1992 - ACS Publications<a href="https://pubs.acs.org/doi/pdf/10.1021/bi00117a036" target="_blank" rel="noreferrer noopener">https://pubs.acs.org/doi/pdf/10.1021/bi00117a036</a> Probing the functional conformation of the tridecapeptide mating pheromone of Saccharomyces cerevisiae through study of disulfide-constrained analogs CHUB XUE, A MCKINNEY, HUIFEN LU - journal of peptide , 1996 - Wiley Online Library<a href="https://onlinelibrary.wiley.com/doi/abs/10.1111/j.1399-3011.1996.tb01336.x" target="_blank" rel="noreferrer noopener">https://onlinelibrary.wiley.com/doi/abs/10.1111/j.1399-3011.1996.tb01336.x</a> Spiegel, zyxwvutsrqponm B Molitoris, AC Alfrey, RA Harris, FR Simon - Am. J. Physiol, 1985 - academia.edu<a href="https://www.academia.edu/download/41221846/Antagonistic_and_synergistic_peptide_ana20160115-15517-198v4vt.pdf" target="_blank" rel="noreferrer noopener">https://www.academia.edu/download/41221846/Antagonistic_and_synergistic_peptide_ana20160115-15517-198v4vt.pdf</a> Long-distance rotational echo double resonance measurements for the determination of secondary structure and conformational heterogeneity in peptides B Arshava, M Breslav, O Antohi, RE Stark - Solid State Nuclear , 1999 - Elsevier<a href="https://www.sciencedirect.com/science/article/pii/S0926204099000181" target="_blank" rel="noreferrer noopener">https://www.sciencedirect.com/science/article/pii/S0926204099000181</a> Synthesis of biologically active analogs of the dodecapeptide alpha-factor mating pheromone of Saccharomyces cerevisiae A EWENSON, S MARCUS - Journal of Peptide , 1990 - Wiley Online Library<a href="https://onlinelibrary.wiley.com/doi/abs/10.1111/j.1399-3011.1990.tb00944.x" target="_blank" rel="noreferrer noopener">https://onlinelibrary.wiley.com/doi/abs/10.1111/j.1399-3011.1990.tb00944.x</a></p>

<p>Peptide H-WRQAAFVDSY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>TAPI-2 is an inhibitor of ADAM-17 (also called TACE) and matrix metalloproteinases (MMPs). It acts as a broad-spectrum inhibitor of these enzymes. TAPI-2 prevents the shedding of tumor necrosis factor-alpha (TNF-α) from cell membranes and can sensitize cancer stem cells to the effects of chemotherapy such as 5-fluorouracil (5-FU) in vitro. It also blocks the phorbol ester-induced shedding of other cell surface proteins like TGF-α and β-amyloid precursor protein.</p>

<p>Peptide H-GPGGAWAAEVISNAR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Key subunit of extracellular plaques found in the brains of patients with Alzheimer's disease. TFA salt; 95%.</p>

<p>A hydroxamate-based inhibitor of collagenase, gelatinase, and TACE. TACE stands for Tumor Necrosis Factor-α Converting Enzyme. It is also known as ADAM17 (A Disintegrin and Metalloproteinase 17)</p>

<p>Peptide H-VIYEQANAHGQ-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Tripeptide for research purposes. Typically 95%.</p>

<p>Peptide H-ALVEICTEM-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Prostaglandin A1 is a bioactive lipid, which is derived from arachidonic acid through enzymatic pathways. It functions as a signaling molecule with various biological activities, influencing vascular tone, inflammation, and smooth muscle activity. Prostaglandins are a subset of eicosanoids, which are synthesized from essential fatty acids found within phospholipid membranes of cells.</p>

<p>Peptide H-VVSEDFLQDVSASTK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-TEFTTALQR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>H-NKWGNAVIGAATGATRGVSWCRGFGPWGMTACGLGGAAIGGYLGYKSN-OH is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote Tool</p>

<p>Peptide H-IYQEPFKNLK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-VYIHPF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-NWAPGEPNNR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-MRWQEMGYIFYPRKLR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>UM171 is a small-molecule compound, which is derived from synthetic chemical processes with properties that enable the expansion of human hematopoietic stem cells (HSCs) in vitro. It acts by targeting and modulating specific cellular pathways to enhance the self-renewal and proliferation of HSCs without inducing differentiation.<br><br>The primary application of UM171 lies in the field of regenerative medicine and transplantation. By facilitating the expansion of HSCs, UM171 holds significant potential in improving the outcomes of bone marrow and cord blood transplants. This is particularly relevant in contexts where donor cell availability is limited or where augmenting the engraftment potential of HSCs is critical. The ability to expand HSCs ex vivo opens avenues for improved treatment of hematological disorders, potentially allowing for more effective and accessible transplant therapies. Researchers are exploring its utility in diverse experimental setups, aiming to translate this compound's capabilities into clinical settings to enhance patient outcomes in hematopoietic recovery and therapy.</p>

<p>Peptide H-ALNRTSSDSALHRRR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-ALNRTSSDSALHRRR-OH include the following: Enhanced activation of cellular AMPK by dual-small molecule treatment: AICAR and A769662 S Ducommun , RJ Ford, L Bultot - American Journal , 2014 - journals.physiology.org<a href="https://journals.physiology.org/doi/abs/10.1152/ajpendo.00672.2013" target="_blank" rel="noreferrer noopener">https://journals.physiology.org/doi/abs/10.1152/ajpendo.00672.2013</a> Characterization of WZ4003 and HTH-01-015 as selective inhibitors of the LKB1-tumour-suppressor-activated NUAK kinases S Banerjee , SJ Buhrlage, HT Huang , X Deng - Biochemical , 2014 - portlandpress.com<a href="https://portlandpress.com/biochemj/article-abstract/457/1/215/46906" target="_blank" rel="noreferrer noopener">https://portlandpress.com/biochemj/article-abstract/457/1/215/46906</a> Interplay between Polo kinase, LKB1-activated NUAK1 kinase, PP1betaMYPT1 phosphatase complex and the SCFbetaTrCP E3 ubiquitin ligase S Banerjee , A Zagorska, M Deak - Biochemical , 2014 - portlandpress.com<a href="https://portlandpress.com/biochemj/article-abstract/461/2/233/46874" target="_blank" rel="noreferrer noopener">https://portlandpress.com/biochemj/article-abstract/461/2/233/46874</a> Inhibition of SIK2 and SIK3 during differentiation enhances the anti-inflammatory phenotype of macrophages NJ Darling , R Toth, JSC Arthur , K Clark - Biochemical Journal, 2017 - portlandpress.com<a href="https://portlandpress.com/biochemj/article-abstract/474/4/521/49590" target="_blank" rel="noreferrer noopener">https://portlandpress.com/biochemj/article-abstract/474/4/521/49590</a> Comparison of the specificity of Trk inhibitors in recombinant and neuronal assays KJ Martin, N Shpiro, R Traynor, M Elliott , JSC Arthur - Neuropharmacology, 2011 - Elsevier<a href="https://www.sciencedirect.com/science/article/pii/S0028390811001389" target="_blank" rel="noreferrer noopener">https://www.sciencedirect.com/science/article/pii/S0028390811001389</a> Enhanced activation of cellular AMPK by dual small GR Kemp, K Sakamoto - 2014 - journals.physiology.org<a href="https://journals.physiology.org/doi/prev/20140114-aop/epdf/10.1152/ajpendo.00672.2013" target="_blank" rel="noreferrer noopener">https://journals.physiology.org/doi/prev/20140114-aop/epdf/10.1152/ajpendo.00672.2013</a> The AMPK-related kinase SIK2 is regulated by cAMP via phosphorylation at Ser358 in adipocytes E Henriksson, HA Jones, K Patel , M Peggie - Biochemical , 2012 - portlandpress.com<a href="https://portlandpress.com/biochemj/article-abstract/444/3/503/46279" target="_blank" rel="noreferrer noopener">https://portlandpress.com/biochemj/article-abstract/444/3/503/46279</a></p>

<p>Peptide H-VAANIVLTV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Please enquire for more information about Elafibranor including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Peptide H-GDSLAYGLR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-NLDTASTTL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-GYGFGLIK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

SDS-PAGE is a method employed for separating proteins via electrophoresis, based on the principle that charged molecules migrate through a matrix in response to an applied electric field. The matrix utilized for this separation is polyacrylamide, which is derived from acrylamide, a compound that can be hazardous. Polyacrylamide is commonly used for the size-based separation of proteins and nucleic acids. The gel matrix forms through the free radical polymerization of acrylamide along with a crosslinking agent known as N, N-Methylenebisacrylamide. In this process, acrylamide monomers polymerize into long chains, initiated by a free radical-generating system, and these chains are linked by the cross-linker, resulting in a gel structure. This gel is crucial for effective electrophoretic separation, facilitating the analysis of biomolecules based on size.