Acides carboxyliques
Les acides carboxyliques sont des molécules organiques caractérisées par un groupe fonctionnel de type carboxyle (-COOH). Ces acides sont fondamentaux dans diverses réactions chimiques, y compris l'estérification, l'amidation et la décarboxylation. Les acides carboxyliques sont largement utilisés dans la production de produits pharmaceutiques, de polymères et d'agrochimiques. Dans cette section, vous pouvez trouver un grand nombre d'acides carboxyliques prêts à l'emploi. Chez CymitQuimica, nous fournissons une large gamme d'acides carboxyliques de haute qualité pour soutenir vos applications de recherche et industrielles.
12457 produits trouvés pour "Acides carboxyliques"
Trier par
Degré de pureté (%)
0
100
|
0
|
50
|
90
|
95
|
100
Biotinyl-Obestatin (rat) trifluoroacetate salt
CAS :Please enquire for more information about Biotinyl-Obestatin (rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C124H188N36O33SDegré de pureté :Min. 95%Masse moléculaire :2,743.11 g/molGLP-2 (1-33) (human) ammonium acetate salt
CAS :Please enquire for more information about GLP-2 (1-33) (human) ammonium acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C165H254N44O55SDegré de pureté :Min. 95%Masse moléculaire :3,766.11 g/mol3-Cyanopropanoic acid
CAS :3-Cyanopropanoic acid is a reactive compound that forms a complex with palladium. It is produced by the reaction of acrylonitrile and chloride in the presence of a base such as sodium hydroxide. The reaction mechanism is shown below:Formule :C4H5NO2Degré de pureté :Min. 95%Couleur et forme :PowderMasse moléculaire :99.09 g/mol(1S,2R)-Fmoc-aminocyclohexane carboxylic acid
CAS :Please enquire for more information about (1S,2R)-Fmoc-aminocyclohexane carboxylic acid including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C22H23NO4Degré de pureté :Min. 95%Masse moléculaire :365.42 g/molEthyl 4-methoxyphenylacetate
CAS :Ethyl 4-methoxyphenylacetate is a fatty acid that is synthesized by the condensation of aniline and pyrrole. It has been shown to inhibit the growth of bacteria, such as Salmonella typhi and Staphylococcus aureus, in vitro. The inhibition of bacterial growth is thought to be due to its ability to react with hydrogen fluoride, which results in the formation of reactive oxygen species and nitrogen radicals. This compound also inhibits the production of tyrosinase in human skin cells, which may be beneficial for individuals with acne. Ethyl 4-methoxyphenylacetate has been shown to be safe for use in clinical trials.Formule :C11H14O3Degré de pureté :Min. 95%Couleur et forme :Clear LiquidMasse moléculaire :194.23 g/mol2-Chloro-3,4-dihydroxybenzoic acid
CAS :Cefepime is a broad-spectrum antibiotic that is used to treat bacterial infections. It inhibits cell wall synthesis by binding to the penicillin-binding proteins and interfering with the cross-linking of peptidoglycan. Cefepime has been shown to be active against gram-negative pathogens such as Aeruginosa, Stenotrophomonas maltophilia, and P. aeruginosa. Cefepime also inhibits the growth of gram-positive bacteria such as Staphylococcus aureus, Enterococcus faecalis, and Streptococcus pneumoniae. The chemical structure of cefepime is similar to that of other beta-lactam antibiotics like methicillin, oxacillin, cloxacillin, ampicillin, and amoxicillin. Cefepime has been shown to be effective in treating resistant gram-negative organisms such as Pseudomonas aeruginosa (P.Formule :C7H5ClO4Degré de pureté :Min. 95%Couleur et forme :White To Yellow To Light Brown SolidMasse moléculaire :188.56 g/molACTH (3-24) (human, bovine, rat) trifluoroacetate salt
CAS :Please enquire for more information about ACTH (3-24) (human, bovine, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C124H196N38O27SDegré de pureté :Min. 95%Masse moléculaire :2,683.19 g/molKisspeptin-54 (27-54) (human) trifluoroacetate salt
CAS :Please enquire for more information about Kisspeptin-54 (27-54) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C149H226N42O39Degré de pureté :Min. 95%Masse moléculaire :3,229.65 g/mol3-(3,5-Dimethoxyphenyl)propionic acid methyl ester
CAS :3-(3,5-Dimethoxyphenyl)propionic acid methyl ester is a reagent that is used as a reactant in organic synthesis. It is also useful as a scaffold for the synthesis of heterocycles and other complex compounds. 3-(3,5-Dimethoxyphenyl)propionic acid methyl ester is used in research chemical synthesis and as a versatile building block for the production of fine chemicals. This chemical can be used to create products such as pharmaceuticals, pesticides, and cosmetics.Formule :C12H16O4Degré de pureté :Min. 95%Masse moléculaire :224.25 g/molInfluenza PR8 Hemagglutinin Peptide (110-119) trifluoroacetate salt
CAS :Influenza PR8 Hemagglutinin Peptide (110-119) trifluoroacetate salt H-Ser-Phe-Glu-Arg-Phe-Glu-Ile-Phe-Pro-Lys-OH trifluoroacetate sa lt is a surface glycoprotein that has been shown to enhance the survival of neuronal cells. It is also involved in the regulation of energy metabolism and iron homeostasis, as well as in the induction of autoimmune diseases. This peptide contains a hydroxyl group, which can be oxidized by reactive oxygen species and may have neurotrophic effects. Trifluoroacetate salts of this protein are ester linkages that bind iron tightly and have been used for the treatment of iron overload.Formule :C63H90N14O16Degré de pureté :Min. 95%Masse moléculaire :1,299.47 g/molMethyl 6-bromo-1,2-dihydro-2-oxo-4-pyridineacetate
CAS :Please enquire for more information about Methyl 6-bromo-1,2-dihydro-2-oxo-4-pyridineacetate including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C8H8BrNO3Degré de pureté :Min. 95%Masse moléculaire :246.06 g/molAlpha-Conotoxin MI trifluoroacetate salt
CAS :Produit contrôléA component of Conus venom; antagonist of nicotinic acetylcholine receptorsFormule :C58H88N22O17S4Degré de pureté :Min. 95%Masse moléculaire :1,493.72 g/molPep-1-cysteamide trifluoroacetate salt
CAS :Please enquire for more information about Pep-1-cysteamide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C140H202N36O33SDegré de pureté :Min. 95%Masse moléculaire :2,949.39 g/mol(Arg8)-Conopressin G trifluoroacetate salt
CAS :Please enquire for more information about (Arg8)-Conopressin G trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C44H71N17O10S2Degré de pureté :Min. 95%Masse moléculaire :1,062.28 g/molH-Glu(Ala-Gly-pNA)-OH trifluoroacetate salt
CAS :Please enquire for more information about H-Glu(Ala-Gly-pNA)-OH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C16H21N5O7Degré de pureté :Min. 95%Masse moléculaire :395.37 g/mol(D-Arg0, Hyp 3,Igl5,D-Igl7, Oic 8)-Bradykinin trifluoroacetate salt
CAS :Please enquire for more information about (D-Arg0, Hyp 3,Igl5,D-Igl7, Oic 8)-Bradykinin trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formule :C64H95N19O13Degré de pureté :Min. 95%Masse moléculaire :1,338.56 g/molBiotinyl-(Des-Bromo)-Neuropeptide B (1-23) (human) trifluoroacetate salt
CAS :Please enquire for more information about Biotinyl-(Des-Bromo)-Neuropeptide B (1-23) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C117H176N32O32SDegré de pureté :Min. 95%Masse moléculaire :2,574.91 g/molBoc-Leu-Ser-Thr-Arg-AMC trifluoroacetate salt
CAS :Boc-Leu-Ser-Thr-Arg-AMC trifluoroacetate salt is a synthetic substrate that is used in enzyme assays. The hydrolysis of the peptidyl ester bond by the enzyme results in release of AMC and an unstable intermediate, which reacts with AMC to form a stable fluorescent product. This product can be detected using various chromatographic techniques. Boc-Leu-Ser-Thr-Arg-AMC trifluoroacetate salt has been shown to be an effective anticoagulant for blood clotting and it is also used as a second order rate constant in the determination of coagulation factors.Formule :C34H52N8O10Degré de pureté :Min. 95%Masse moléculaire :732.82 g/molTri-tert-butyl 1,4,7,10-Tetraazacyclododecane-1,4,7-triacetate
CAS :Tri-tert-butyl 1,4,7,10-Tetraazacyclododecane-1,4,7-triacetate is a molecule that has been used in the diagnosis of cervical cancer. This drug binds to the metal chelator and is then attached to a water molecule by the functional group. This process makes the compound more stable and prevents it from reacting with other molecules. The cyclic peptide is then attached to the tri-tert-butyl 1,4,7,10-Tetraazacyclododecane-1,4,7-triacetate molecule which can be detected by an MRI scan.Formule :C26H50N4O6Degré de pureté :Min. 95%Masse moléculaire :514.7 g/molCRAMP (mouse) trifluoroacetate salt
CAS :Please enquire for more information about CRAMP (mouse) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C178H302N50O46Degré de pureté :Min. 95%Masse moléculaire :3,878.61 g/molFmoc-epsilon-aminocaproic acid-Wang resin (200-400 mesh)
Please enquire for more information about Fmoc-epsilon-aminocaproic acid-Wang resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this pageDegré de pureté :Min. 95%Diphenolic acid
CAS :Diphenolic acid is a reactive compound that is used as a solid catalyst. It has a hydroxyl group and a fatty acid, which makes it soluble in organic solvents. The methyl ethyl ester of diphenolic acid can be obtained from the reaction of diphenolic acid with methanol, ethanol or ethylene glycol. Diphenolic acid can also be obtained by reacting dibenzalacetone with an alcohol. Diphenolic acid has been used to synthesize monoclonal antibodies and linear calibration curves for electrochemical impedance spectroscopy. The hydroxyl group on diphenolic acid allows it to undergo reactions that are not possible for other compounds such as phenols, leading to its use in surface methodology and flow systems.Formule :C17H18O4Couleur et forme :White PowderMasse moléculaire :286.32 g/mol(2-Chlorophenyl)boronic acid
CAS :2-Chlorophenylboronic acid is a diphenyl ether that can be used as a building block for the synthesis of benzodiazepine receptor ligands. It has been shown to be an efficient nucleophile, leading to the formation of carbonyl groups in the presence of halides. 2-Chlorophenylboronic acid has also been shown to inhibit p38 kinase activity and may be useful for anticancer therapy.Formule :C6H6BClO2Degré de pureté :Min. 95%Masse moléculaire :156.37 g/molACTH (4-10) trifluoroacetate salt
CAS :ACTH (4-10) trifluoroacetate salt is a cholinergic agent that belongs to the class of neurotransmitters. It is synthesized from the naturally occurring hormone ACTH, which is released by the anterior pituitary gland in response to a variety of stimuli. This compound has been shown to have physiological effects on various organs, including adipose tissue and locomotor activity. It also shows neuroprotective effects in animal models and has neurotrophic properties. The therapeutic potential of this compound for brain functions is currently being explored.Formule :C44H59N13O10SDegré de pureté :Min. 95%Masse moléculaire :962.09 g/moltert-Butyl cis-4-hydroxycyclohexylcarbamate
CAS :Tert-butyl cis-4-hydroxycyclohexylcarbamate is a pharmacological agent that has been shown to have anticonvulsant activity. It is a phenytoin amide that has neurotoxic effects and can cause convulsions. Tert-butyl cis-4-hydroxycyclohexylcarbamate binds to the sulfonamide site on the enzyme GABA transaminase, which converts GABA into succinic semialdehyde, thereby inhibiting the synthesis of GABA. This drug also inhibits the production of acetaldehyde from ethanol by preventing oxidation of NADH and NADPH. The tert-butyl cis-4-hydroxycyclohexylcarbamate was found to have an anticonvulsant effect in animals when given intravenously and orally. It also showed a protective effect against electroshock seizures in rats, suggesting an anticonvulsant activity.Formule :C11H21NO3Degré de pureté :Min. 95%Couleur et forme :White PowderMasse moléculaire :215.29 g/molH-Gly-Gly-Lys-Arg-OH acetate salt
CAS :The H-Gly-Gly-Lys-Arg-OH acetate salt is a diagnostic agent that belongs to the group of active analogues. It is an analogue of sialin, a compound that has been shown to be involved in the molecular pathogenesis of cancer tissues. Sialic acid is an important component of many glycoproteins and glycolipids found in the human body. This compound is metabolized by sialidase enzymes, which are present in various tissues and organs such as the brain, kidney, liver, and plasma. The H-Gly-Gly-Lys-Arg-OH acetate salt inhibits these enzymes by binding to them and preventing their action. This drug also inhibits ATP dependent transport systems for neuronal cells.Formule :C16H32N8O5Degré de pureté :Min. 95%Masse moléculaire :416.48 g/mol5-Acenaphthenecarboxylic acid
CAS :5-Acenaphthenecarboxylic acid is a xylene derivative that has been characterized as an organometallic compound. The cyclopentane ring is the central feature of this molecule and it can be used in the synthesis of other organic compounds. 5-Acenaphthenecarboxylic acid is toxic to humans and animals and has been shown to induce liver tumors in rats. It also has been shown to inhibit the growth of some bacteria, including Mycobacterium tuberculosis, which causes tuberculosis. 5-Acenaphthenecarboxylic acid inhibits protein synthesis by binding to ribosomes and interfering with the biosynthesis of proteins. This binding prevents formation of a complex with the enzyme cell wall synthesis that is required for cell wall biosynthesis, inhibiting protein synthesis and cell division.Formule :C13H10O2Degré de pureté :Min. 95%Couleur et forme :PowderMasse moléculaire :198.22 g/mol2-(4-Chlorophenyl-acetyl)benzoic acid
CAS :2-(4-Chlorophenyl-acetyl)benzoic acid is a fine chemical that is a versatile building block and useful intermediate. 2-(4-Chlorophenyl-acetyl)benzoic acid is used in the manufacture of other chemicals, such as pharmaceuticals, pesticides, dyes, or perfumes. It is also used for research purposes and as a reagent. It has a CAS number of 53242-76-5.Formule :C15H11ClO3Degré de pureté :Min. 95%Couleur et forme :PowderMasse moléculaire :274.7 g/molBombesin (8-14) acetate salt
CAS :Bombesin (8-14) acetate salt H-Trp-Ala-Val-Gly-His-Leu-Met-NH2 acetate salt is a bifunctional peptide that has been shown to inhibit the growth of prostate cancer cells. Bombesin (8-14) acetate salt H-Trp-Ala-Val-Gly-His-Leu-Met-NH2 acetate salt also has antiinflammatory properties and is used in treating inflammatory diseases. It inhibits collagen synthesis and fibrinogen activation, which may be important in the treatment of autoimmune diseases such as rheumatoid arthritis. Bombesin (8 14) acetate salt H Trp Ala Val Gly His Leu Met NH2 Acetate Salt has been shown to have no effect on healthy tissues when administered systemically.Formule :C38H57N11O7SDegré de pureté :Min. 95%Masse moléculaire :812 g/molPancreastatin (33-48) (human) trifluoroacetate salt
CAS :Pancreastatin (33-48) is a synthetic, acidic, sulfated peptide that has been shown to have high activity against pancreatic cancer cells. Pancreastatin (33-48) has been synthesized by reacting an oligopeptide with glutamic acid and aspartic acid. The N-terminal of this peptide is amidated and contains a sulfate group. This molecule has been purified by SDS-polyacrylamide gel electrophoresis and the sulfate fractionation method. Pancreastatin (33-48) is able to inhibit the proliferation of pancreatic tumor cells in vitro, but it does not appear to be cytotoxic to normal pancreatic cells. In addition, pancreastatin (33-48) has also been shown to decrease tumor growth in vivo in mice bearing a transplanted human pancreatic tumor.Formule :C78H123N21O27SDegré de pureté :Min. 95%Masse moléculaire :1,819 g/mol(Leu13)-Motilin (human, porcine) trifluoroacetate salt
CAS :Motilin is a gastrointestinal hormone that stimulates gastric motility and the release of pancreatic enzymes. It is also used to treat postoperative ileus, abdominal pain, and gastroduodenal ulcers. Motilin is administered nasogastrically to stimulate the movement of food through the stomach and intestines. The trifluoroacetate salt form is used in this application because it has a longer duration of action than other salts.Formule :C121H190N34O35Degré de pureté :Min. 95%Masse moléculaire :2,681.01 g/molH-Trp-Phe-Tyr-Ser(PO3H2)-Pro-Arg-pNA trifluoroacetate salt
CAS :Please enquire for more information about H-Trp-Phe-Tyr-Ser(PO3H2)-Pro-Arg-pNA trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C49H59N12O13PDegré de pureté :Min. 95%Masse moléculaire :1,055.04 g/mol(Des-Lys38)-M65 trifluoroacetate salt
CAS :Please enquire for more information about (Des-Lys38)-M65 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C199H314N62O60S5Degré de pureté :Min. 95%Masse moléculaire :4,695.33 g/mol2-Methylpyridine-4-boronic acid
CAS :2-Methylpyridine-4-boronic acid is a reactive molecule that has been used in post-column derivatization and vivo studies. It has been shown to be reactive with mass spectrometric analysis, cancer assays, proteomics, and tumorigenic sample preparation. It also has been shown to have a molecular target of the cytochrome P450 reductase (CPR), which is involved in the metabolism of drugs and other xenobiotics. 2-Methylpyridine-4-boronic acid binds to CPR and inhibits its enzymatic activity, thereby affecting the metabolism of xenobiotics.
Formule :C6H8BNO2Degré de pureté :Min. 95%Couleur et forme :White PowderMasse moléculaire :136.94 g/molH-Pro-Lys-OH acetate salt
CAS :H-Pro-Lys-OH acetate salt is a synthetic compound that is specific for histidine residues. It catalyzes the hydrolysis of fibrinogen to form fibrin, which can be used in the formation of blood clots. This molecule has been shown to have a number of sequences and acid analysis. H-Pro-Lys-OH acetate salt can be used as an additive in food products. The incubation process should be done at pH 4.5 and the reaction should be stopped by adding tripeptides followed by using ion-exchange chromatography or SDS polyacrylamide gel electrophoresis to analyze the amino acids present in the product.
Formule :C11H21N3O3Degré de pureté :Min. 95%Masse moléculaire :243.3 g/molAmyloid Bri Protein (1-23) trifluoroacetate salt
CAS :Please enquire for more information about Amyloid Bri Protein (1-23) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C116H175N31O35S2Degré de pureté :Min. 95%Masse moléculaire :2,627.95 g/molMART-1 (27-35) (human) trifluoroacetate salt
CAS :Produit contrôléPlease enquire for more information about MART-1 (27-35) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C37H67N9O11Degré de pureté :Min. 95%Masse moléculaire :813.98 g/molH-Leu-Ser-Lys-Leu-OH trifluoroacetate salt
CAS :Please enquire for more information about H-Leu-Ser-Lys-Leu-OH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C21H41N5O6Degré de pureté :Min. 95%Masse moléculaire :459.58 g/mol2-Hydroxysuccinic acid methyl ester
CAS :2-Hydroxysuccinic acid methyl ester is an organic compound that has a carbonyl group, a hydroxyl group, and two carboxylic esters. It is a colorless liquid with a sweet taste. 2-Hydroxysuccinic acid methyl ester is classified as a dicarboxylic acid. It can be found in nature as malic acid, which is found in apples and other fruits. 2-Hydroxysuccinic acid methyl ester can also be synthesized from citric acid and formaldehyde.
Formule :C5H8O5Degré de pureté :90% MinMasse moléculaire :148.11 g/mol(D-Ala2)-Leu-Enkephalin-Arg acetate salt
CAS :Please enquire for more information about (D-Ala2)-Leu-Enkephalin-Arg acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C35H51N9O8·xC2H4O2Degré de pureté :Min. 95%Masse moléculaire :725.84 g/molOxindole-4-boronic acid, pinacol ester
CAS :Please enquire for more information about Oxindole-4-boronic acid, pinacol ester including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C14H18BNO3Degré de pureté :Min. 95%Masse moléculaire :259.11 g/molTRAP-6 amide trifluoroacetate salt
CAS :Protease-activated receptor 1 (PAR-1) selective activating peptide, TFA salt. 98%.Formule :C34H57N11O8Degré de pureté :Min. 95%Couleur et forme :PowderMasse moléculaire :747.89 g/mol2-Pyridineboronic acid
CAS :2-Pyridineboronic acid is a chemical compound that belongs to the group of quinoline derivatives. It is used in pharmaceutical preparations, including as an intermediate for the synthesis of other compounds. 2-Pyridineboronic acid has been shown to have antiproliferative effects on cancer cells and has been found to be active against nicotinic acetylcholine receptors (NAR). The compound also inhibits lipid kinase activity, which is involved in the production of phosphatidylcholine and phosphatidylethanolamine from phosphatidylserine. 2-Pyridineboronic acid can react with hydrochloric acid and electrochemical impedance spectroscopy to produce a solution that has a detection time of about 10 minutes.Formule :C5H6BNO2Degré de pureté :Min. 95%Masse moléculaire :122.92 g/molNeuropeptide W-23 (rat) trifluoroacetate salt
CAS :Please enquire for more information about Neuropeptide W-23 (rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C119H183N35O29SDegré de pureté :Min. 95%Masse moléculaire :2,600.01 g/mol(His(3-Me)2)-LHRH trifluoroacetate salt
CAS :Please enquire for more information about (His(3-Me)2)-LHRH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C56H77N17O13·C2HF3O2Degré de pureté :Min. 95%Masse moléculaire :1,310.34 g/mol4-Nitrobenzaldiacetate
CAS :4-Nitrobenzaldiacetate is a crystalline solid that can be obtained by two-dimensional experimental methods. It has been shown to have high reactivity in the presence of ozone and sulfuric acid. The reaction product is the corresponding sulfate salt. The filtration technique is used to separate the desired product from the reaction mixture. This product can also be crystallized with catalytic amounts of sulfuric acid and 4-nitrobenzoic acid. The catalytic oxidation of 4-nitrobenzoic acid to form 4-nitrobenzaldaicetic acid, as well as its subsequent conversion to 4-nitrobenzaldiacetate, are both feasible reactions for this compound.Formule :C11H11NO6Degré de pureté :Min. 95%Couleur et forme :PowderMasse moléculaire :253.21 g/molBenzopyrazine-6-boronic acidHCl
CAS :Please enquire for more information about Benzopyrazine-6-boronic acidHCl including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C8H8BClN2O2Degré de pureté :Min. 95%Masse moléculaire :210.43 g/molBiotinyl-pTH (1-34) (human) trifluoroacetate salt
CAS :Please enquire for more information about Biotinyl-pTH (1-34) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C191H305N57O53S3Degré de pureté :Min. 95%Masse moléculaire :4,344.02 g/molH-Gly-Gly-Arg-anilide acetate salt
CAS :Please enquire for more information about H-Gly-Gly-Arg-anilide acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C16H25N7O3Degré de pureté :Min. 95%Masse moléculaire :363.42 g/mol(R,S)-α-Amino-3-hydroxy-5-methyl-4-isoxazolepropionic acid hydrobromide
CAS :(R,S)-AMPA is a synthetic analog of the excitatory neurotransmitter glutamate, specifically designed to activate AMPA receptors, a subtype of ionotropic glutamate receptors. These receptors are pivotal in mediating fast synaptic transmission in the central nervous system. (R,S)-AMPA serves as a prototypical agonist for AMPA receptors, facilitating the study of receptor function and synaptic plasticity.Formule :C7H10N2O4•HBrDegré de pureté :Min. 95%Masse moléculaire :267.08 g/molD-Lactic acid benzyl ester
CAS :D-Lactic acid benzyl ester is a chiral molecule that can be used as a feedstock for the production of D-lactic acid. It has been shown to catalyze hydrogenation reactions with an enhanced reaction rate and high selectivity when compared to other methods. The catalytic activity of D-lactic acid benzyl ester can be increased by using zeolites or iron catalyst, which are more expensive than the ligand used in this study. In addition, D-lactic acid benzyl ester was found to be more effective at catalysing the reaction between alkenes and hydrogen gas than other known catalysts. These findings indicate that it may be possible to use D-lactic acid benzyl ester as a cost-effective alternative to other catalysts in industrial processes.Formule :C10H12O3Degré de pureté :Min. 95%Masse moléculaire :180.2 g/molH-Lys-Leu-Lys-OH triacetate salt
CAS :Please enquire for more information about H-Lys-Leu-Lys-OH triacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C18H37N5O4•3C2H4O2Degré de pureté :Min. 95%Masse moléculaire :567.67 g/mol2-[(3,5,6-Trichloro-2-pyridinyl)oxy]acetic acid
CAS :Carbaryl is a broad-spectrum insecticide that has been used to control pests in homes, gardens, and agricultural fields. It can be found in many products for use around the home, including flea collars and ant traps. Carbaryl is absorbed by plants through their leaves and roots and can affect photosynthetic activity. Carbaryl also affects plant metabolism by inhibiting proximal tubule function, which leads to an increase in urea nitrogen and urine production. Carbaryl can be toxic to humans when ingested or inhaled. The toxicity of carbaryl depends on its route of exposure (oral, inhalation, or skin). Carbaryl is metabolized through a number of metabolic reactions that include oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid.Formule :C7H4Cl3NO3Degré de pureté :Min. 95%Couleur et forme :PowderMasse moléculaire :256.47 g/mol(Asn7)-Amyloid b-Protein (1-40) trifluoroacetate salt
CAS :(Asn7)-Amyloid b-Protein (1-40) trifluoroacetate salt H-Asp-Ala-Glu-Phe-Arg-His-Asn-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys The product is a compound that has been shown to inhibit the formation of beta amyloid peptides in the brain. It binds to the beta amyloid peptide and prevents its aggregation, thereby preventing the formation of plaques and inhibiting neuronal cell death. The product contains no detectable levels of trehalose, which makes it ideal for use in brain imaging studies. This product may also be used as a predictive biomarker for Alzheimer's disease because it can be detected in cerebrospinal fluid and plasma.Formule :C194H296N54O57SDegré de pureté :Min. 95%Masse moléculaire :4,328.82 g/mol(Gly21)-Amyloid b-Protein (1-40) trifluoroacetate salt
CAS :Please enquire for more information about (Gly21)-Amyloid b-Protein (1-40) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formule :C193H293N53O58SDegré de pureté :Min. 95%Masse moléculaire :4,315.78 g/mol4-Methoxyphenyl boronic acid
CAS :4-Methoxyphenyl boronic acid is a molecule with a hydroxyl group and a boronic acid. It is synthesized by reacting biphenyl with trifluoroacetic acid in the presence of sodium carbonate and palladium-catalyzed coupling. 4-Methoxyphenyl boronic acid has shown to bind to the receptor for fatty acids, which may be due to its structural similarity to p-hydroxybenzoic acid. The protonated form of this molecule has been shown to react with an electrophilic carbon atom and an electron-deficient alkyl or vinyl halide, resulting in ring formation. This reaction is known as the Suzuki coupling reaction.Formule :C7H9BO3Degré de pureté :Min. 95%Couleur et forme :PowderMasse moléculaire :151.96 g/molN-Des(2-diethylamino) metoclopramide acetic acid
CAS :N-Des(2-diethylamino) metoclopramide acetic acid is a benzyl ester of metoclopramide, a prodrug that is metabolized to the active form in the body. It has been shown to be effective against healthy human subjects and hplc analyses of biological samples have shown it to be a metabolite of metoclopramide. N-Des(2-diethylamino) metoclopramide acetic acid is used as a catalyst for catalytic hydrogenation reactions, such as the conversion of methyl esters into ethyl or butyl esters. It can also be used for catalytic hydrogenation reactions with diazomethane, such as those required for the synthesis of quinolones.Formule :C10H11ClN2O4Degré de pureté :Min. 95%Masse moléculaire :258.66 g/mol(5-Bromo-2-methoxyphenyl)acetic acid
CAS :5-Bromo-2-methoxyphenyl)acetic acid (BMPEA) is a hydroxylated derivative of aspartic acid. It has been shown to induce apoptotic cell death in various cell lines, including human lung cells and rat hippocampal cells. BMPEA is synthesized by the solid-phase method and is characterized by a constant structure. It can be used to treat degenerative diseases and other conditions where apoptosis is desirable, such as Alzheimer's disease, Parkinson's disease, amyotrophic lateral sclerosis, retinitis pigmentosa, and Duchenne muscular dystrophy.Formule :C9H9BrO3Degré de pureté :Min. 95%Couleur et forme :PowderMasse moléculaire :245.07 g/mol(Asp76)-pTH (39-84) (human) trifluoroacetate salt
CAS :Please enquire for more information about (Asp76)-pTH (39-84) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C211H356N66O73Degré de pureté :Min. 95%Masse moléculaire :4,985.49 g/mol(1-Methyl-1H-pyrazol-4-yl)boronic acid
CAS :(1-Methyl-1H-pyrazol-4-yl)boronic acid is a boronic acid that has been used for the synthesis of a number of heterocyclic compounds. Boronic acids are commonly used to synthesize phosphine ligands, which are reactive and can be used in cross-coupling reactions with organic halides, triflates, and tosylates. The efficiency of the reaction depends on the functional group present on the boron atom. (1-Methyl-1H-pyrazol-4-yl)boronic acid can inhibit the activity of many types of enzymes, including those involved in bacterial DNA synthesis and protein synthesis. (1-Methyl-1H-pyrazol-4-yl)boronic acid has been shown to have pharmacokinetic properties that depend on its ionization state.Formule :C4H7BN2O2Degré de pureté :Min. 95%Masse moléculaire :125.92 g/molAc-Gly-Ala-Lys-AMC trifluoroacetate salt
Please enquire for more information about Ac-Gly-Ala-Lys-AMC trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C23H31N5O6Degré de pureté :Min. 95%Masse moléculaire :473.52 g/molCaloxin 2A1 trifluoroacetate salt
CAS :Please enquire for more information about Caloxin 2A1 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C64H91N19O22Degré de pureté :Min. 95%Masse moléculaire :1,478.52 g/molH-Val-Lys-Lys-Arg-OH acetate salt
CAS :Produit contrôléPlease enquire for more information about H-Val-Lys-Lys-Arg-OH acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C23H47N9O5Degré de pureté :Min. 95%Masse moléculaire :529.68 g/molGRF (ovine, caprine) trifluoroacetate salt
CAS :Growth hormone-releasing factor (GRF) or GHRH (growth hormone-releasing hormone).Binds to the growth hormone-releasing hormone receptor (GHRH-R), causing growth hormone secretion.porcine: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGERNQEQGARVRL-NH2bovine: H-YADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2ovine: H-YADAIFTNSYRKILGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2human: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2Formule :C221H368N72O66SDegré de pureté :Min. 95%Masse moléculaire :5,121.8 g/molH-Cys-psi(CH2NH)Val-psi(CH2NH)Phe-Met-OH trifluoroacetate salt
CAS :FTI-277 is a peptidomimetic compound that inhibits HIV-1 protease. FTI-277 is an orally active, potent, and selective inhibitor of HIV-1 protease. The drug has been shown to be effective in the treatment of HIV infection in various clinical trials. FTI-277 inhibited HIV replication in activated cells and disrupted virion production by binding to the target enzyme. FTI-277 also has potential for use as a diagnostic tool for detecting the presence of HIV in body fluids.Formule :C22H38N4O3S2Degré de pureté :Min. 95%Masse moléculaire :470.69 g/mol(Gly14)-Humanin (human) trifluoroacetate salt
CAS :Please enquire for more information about (Gly14)-Humanin (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C118H202N34O31S2Degré de pureté :Min. 95%Masse moléculaire :2,657.21 g/mol(D-Trp6)-LHRH acetate salt
CAS :Please enquire for more information about (D-Trp6)-LHRH acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C64H82N18O13·xC2H4O2Degré de pureté :Min. 95%Masse moléculaire :1,311.45 g/mol3-Maleimidophenyl boronic acid
CAS :Please enquire for more information about 3-Maleimidophenyl boronic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formule :C10H8NO4BDegré de pureté :Min. 95%Masse moléculaire :216.99 g/molNocistatin (bovine) trifluoroacetate salt
CAS :Please enquire for more information about Nocistatin (bovine) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C82H135N21O32Degré de pureté :Min. 95%Masse moléculaire :1,927.07 g/moltert-Butyl 7-bromo-3,4-dihydroisoquinoline-2(1H)-carboxylate
CAS :Please enquire for more information about tert-Butyl 7-bromo-3,4-dihydroisoquinoline-2(1H)-carboxylate including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formule :C14H18BrNO2Degré de pureté :Min. 95%Couleur et forme :PowderMasse moléculaire :312.2 g/molO-a-Hippuryl-L-argininic acid hydrochloride salt
CAS :Please enquire for more information about O-a-Hippuryl-L-argininic acid hydrochloride salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C15H20N4O5Degré de pureté :Min. 95%Masse moléculaire :336.34 g/mol4-(Dodecyloxy)benzoic Acid
CAS :4-(Dodecyloxy)benzoic acid is a white crystalline solid that can be synthesized from triazine, fatty acid, and 4-hydroxyphenylacetic acid. It has been found to be an efficient photosensitizer for the generation of singlet oxygen in organic systems. The photochemical properties of this compound have been studied using FT-IR spectroscopy and light emission and it has been found to emit in the near infrared region. 4-(Dodecyloxy)benzoic acid also has a mesomorphic phase, which can be seen as a change in its optical properties when heated or cooled. This chemical is hydrophobic with low solubility in water.Degré de pureté :Min. 95%TIMP-2 (145-168) (human, bovine) trifluoroacetate salt
Please enquire for more information about TIMP-2 (145-168) (human, bovine) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C131H189N33O35S3Degré de pureté :Min. 95%Masse moléculaire :2,882.3 g/molpTH (1-84) (dog) trifluoroacetate salt
Please enquire for more information about pTH (1-84) (dog) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formule :C414H672N122O128S2Degré de pureté :Min. 95%Masse moléculaire :9,470.64 g/mol(Asn670,Leu671)-Amyloid b/A4 Protein Precursor770 (667-676) trifluoroacetate salt
CAS :Please enquire for more information about (Asn670,Leu671)-Amyloid b/A4 Protein Precursor770 (667-676) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C50H78N14O19Degré de pureté :Min. 95%Masse moléculaire :1,179.24 g/molMethyl 2,2-difluoro-2-(fluorosulfonyl)acetate
CAS :Methyl 2,2-difluoro-2-(fluorosulfonyl)acetate is a chemical that belongs to the group of halides. It has a redox potential of -0.274 V (vs SCE). The methyl group in this chemical is substituted with a fluoro group and a sulfonyl group. The methyl 2,2-difluoro-2-(fluorosulfonyl)acetate has been shown to have receptor activity with dopamine as its agonist. This chemical also has an aromatic hydrocarbon ring and an oxygen atom. Methyl 2,2-difluoro-2-(fluorosulfonyl)acetate has been shown to be effective against cancer cells and may have metabolic disorders such as diabetes mellitus type II and Alzheimer's disease.Formule :C3H3F3O4SDegré de pureté :Min. 95%Couleur et forme :Clear LiquidMasse moléculaire :192.11 g/mol(D-Arg2)-Dermorphin (1-4) amide trifluoroacetate salt
CAS :Please enquire for more information about (D-Arg2)-Dermorphin (1-4) amide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C26H36N8O5Degré de pureté :Min. 95%Masse moléculaire :540.61 g/mol(His(3-Me)2)-TRH trifluoroacetate salt
CAS :Please enquire for more information about (His(3-Me)2)-TRH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C17H24N6O4Degré de pureté :Min. 95%Masse moléculaire :376.41 g/molNeuropeptide Y (porcine) trifluoroacetate salt
CAS :Neuropeptide Y (porcine) trifluoroacetate salt H-Tyr-Pro-Ser-Lys-Pro-Asp-Asn-Pro-Gly-Glu-Asp-Ala-Pro-Ala-Glu-Asp-Leu -Ala -Arg Tyr Tyr Ser Ala Leu Arg His Tyr Ile Asn Leu Ile Thr Arg Gln Arg Tyr NH2 trifluoroacetate salt is a peroxidase enzyme that is biotinylated and purified from porcine sources. It has been used as an antiserum in the development of a plate sealer.
Formule :C190H287N55O57Degré de pureté :Min. 95%Masse moléculaire :4,253.65 g/molGRPP (human) trifluoroacetate salt
CAS :Please enquire for more information about GRPP (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C136H215N41O58SDegré de pureté :Min. 95%Masse moléculaire :3,384.47 g/mol5-FAM-HIV-1 tat Protein (47-57) trifluoroacetate salt
CAS :Please enquire for more information about 5-FAM-HIV-1 tat Protein (47-57) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C85H128N32O20Degré de pureté :Min. 95%Masse moléculaire :1,918.13 g/mol(Phe13,Tyr19)-MCH (human, mouse, rat) trifluoroacetate salt
CAS :Please enquire for more information about (Phe13,Tyr19)-MCH (human, mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C109H160N30O26S4Degré de pureté :Min. 95%Masse moléculaire :2,434.89 g/molBovine Pineal Antireproductive Tripeptide acetate salt
CAS :Bovine pineal antiprogestin tripeptide acetate salt H-Thr-Ser-Lys-OH acetate salt is a molecule that binds to the prolactin receptor. It is a hydroxyl group reactive, carboxy terminal β amino acid analog of prolactin. It has been shown to have inhibitory properties in cancer cells and can be used as a diagnostic agent for tumor growth. This molecule also inhibits the activity of the prolactin receptor with micrometer-sized particles and has diagnostic potential in breast cancer cells.Formule :C13H26N4O6Degré de pureté :Min. 95%Masse moléculaire :334.37 g/molSperm Peptide P10G trifluoroacetate salt
CAS :Please enquire for more information about Sperm Peptide P10G trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C36H58N10O13Degré de pureté :Min. 95%Masse moléculaire :838.91 g/mol(Arg3)-Amyloid b-Protein (1-40) trifluoroacetate salt
CAS :Please enquire for more information about (Arg3)-Amyloid b-Protein (1-40) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C195H300N56O56SDegré de pureté :Min. 95%Masse moléculaire :4,356.88 g/mol(p-Chloro-D-Phe6,Leu17)-VIP (human, mouse, rat) trifluoroacetate salt
CAS :VIP is a potent vasoactive neuropeptide that is found in the heart, brain, and gut. It has been shown to be a potent inhibitor of guanethidine-induced contractions in the femoral vein, as well as atrial contractions. VIP also inhibits spontaneous contractions in the fundic region of the stomach and intestinal motility. VIP has been shown to inhibit vasoactive intestinal polypeptide-induced contractions in isolated rat ileum. VIP is expressed primarily in the enteric nervous system and throughout the gastrointestinal tract.Formule :C148H239ClN44O42Degré de pureté :Min. 95%Masse moléculaire :3,342.21 g/mol(D-Tyr5,D-Trp6)-LHRH trifluoroacetate salt
CAS :Please enquire for more information about (D-Tyr5,D-Trp6)-LHRH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C64H82N18O13Degré de pureté :Min. 95%Masse moléculaire :1,311.45 g/molSauvagine trifluoroacetate salt
CAS :Sauvagine is a trifluoroacetate salt of Pyr-Gly-Pro-Pro-Ile-Ser-Ile-Asp-Leu-Ser-Leu-Glu-Leu-Leu-Arg. It has been used as a model system to study the effects of trifluoroacetic acid on brain functions. Sauvagine has also been shown to have inhibitory effects on cyclase enzymes, which are involved in the synthesis of steroids and other hormones. This compound has also been found to have an effect on locomotor activity and receptor activity.Formule :C202H346N56O63SDegré de pureté :Min. 95%Masse moléculaire :4,599.31 g/molNeuromedin N trifluoroacetate salt
CAS :Neuromedin N trifluoroacetate salt is a neurotrophin that regulates the growth and differentiation of nerve cells. It has been shown to increase locomotor activity in rats and to activate the receptor for neurotrophins. Neuromedin N trifluoroacetate salt also binds to response elements in DNA and can also modulate camp levels, cytosolic calcium, and protein kinase C levels in cells. This molecule has been shown to have antinociceptive properties by inhibiting the pain-causing action of substance P on sensory neurons. It is possible that this drug may be used as a growth factor or as a messenger RNA (mRNA) in fatty acid synthesis.Formule :C38H63N7O8Degré de pureté :Min. 95%Masse moléculaire :745.95 g/molC-Peptide 1 (rat) trifluoroacetate salt
CAS :Please enquire for more information about C-Peptide 1 (rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C140H228N38O51Degré de pureté :Min. 95%Masse moléculaire :3,259.53 g/mol5-Formyl-2,4-dimethyl-1H-pyrrole-3-carboxylic acid
CAS :5-Formyl-2,4-dimethyl-1H-pyrrole-3-carboxylic acid is a chemical compound that is used in the formylation of amines to produce formamides. It has been optimized for industrial production by optimizing reaction time, formylation conditions, and solvents. It has also been shown that 5-formyl-2,4-dimethyl-1H-pyrrole-3-carboxylic acid produces good yields and high product purity.
Formule :C8H9NO3Degré de pureté :Min. 95%Masse moléculaire :167.16 g/mol1,4-Dihydro-2,6-dimethyl-4-(3-nitrophenyl)-3,5-pyridinedicarboxylic acid 3-methyl ester
CAS :Lercanidipine is a calcium antagonist that binds to the calcium channels in the membranes of cells, preventing the entry of calcium ions. Lercanidipine is water soluble and can be synthesized using techniques such as elemental analysis and pharmacological techniques. It is also an ionizable drug, which means that its affinity for chloride varies with pH. Lercanidipine has been shown to have strong affinity for erythrocyte membranes and thus has a high selectivity for vascular smooth muscle cells. This drug also has a low toxicity profile and does not affect tissues other than vascular smooth muscle cells.Formule :C16H16N2O6Degré de pureté :Min. 95%Couleur et forme :White PowderMasse moléculaire :332.31 g/molAmyloid beta-Protein (1-24) trifluoroacetate salt
CAS :Please enquire for more information about Amyloid beta-Protein (1-24) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C130H183N35O40Degré de pureté :Min. 95%Masse moléculaire :2,876.06 g/molAc-Val-Glu-His-Asp-AFC trifluoroacetate salt
CAS :Please enquire for more information about Ac-Val-Glu-His-Asp-AFC trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C32H36F3N7O11Degré de pureté :Min. 95%Masse moléculaire :751.66 g/molBoc-Val-Leu-Lys-AMC acetate salt
CAS :Boc-Val-Leu-Lys-AMC acetate salt is a protease inhibitor that binds to the active site of trypsin and inhibits its proteolytic activity. It has been shown to protect neuronal cells from death caused by amyloid beta (Aβ) peptide. Boc-Val-Leu-Lys-AMC acetate salt also inhibits the secretion of proinflammatory cytokines and reduces the permeability of mitochondrial membranes in human neutrophils. This drug is stable in acidic environments, with a pH optimum of 2.0, but is sensitive to alkaline conditions with a pH optimum of 8.5. Boc-Val-Leu-Lys-AMC acetate salt has been shown to bind to casein, which may result in high values on sephadex g100 chromatography.Formule :C32H49N5O7•C2H4O2Degré de pureté :Min. 98 Area-%Couleur et forme :PowderMasse moléculaire :675.81 g/molH-Phe-Leu-Arg-Phe-NH2 acetate salt
CAS :H-Phe-Leu-Arg-Phe-NH2 acetate salt is a peptide that has been shown to inhibit neuronal activity in the Xenopus oocyte. This inhibition is biphasic and can be reversed by the addition of an excess of glutamate. It has been shown to have an inhibitory effect on the release of neurotransmitters from the isolated heart, ganglia, and subesophageal ganglion. The sequence of H-Phe-Leu-Arg-Phe-NH2 acetate salt has been determined as carboxy terminal. The physiological effects of H-Phe-Leu-Arg-Phe-NH2 acetate salt are related to its receptor binding properties.Formule :C30H44N8O4Degré de pureté :Min. 95%Masse moléculaire :580.72 g/molNeuropeptide W-30 (human) trifluoroacetate salt
CAS :Please enquire for more information about Neuropeptide W-30 (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C165H249N49O37SDegré de pureté :Min. 95%Masse moléculaire :3,543.12 g/molOsteoblast Activating Peptide (mouse, rat) trifluoroacetate salt
CAS :Please enquire for more information about Osteoblast Activating Peptide (mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C120H196N38O37Degré de pureté :Min. 95%Masse moléculaire :2,763.07 g/molH-D-Pro-Phe-Arg-chloromethylketone trifluoroacetate salt
CAS :H-D-Pro-Phe-Arg-chloromethylketone trifluoroacetate salt is a polyvalent antivenom that is used in the treatment of snakebites and insect stings. It has been shown to be effective in the treatment of life-threatening envenomations, including bites from cobras and other rattlesnakes. This drug is not active against nonactivated venom, such as those from bees or spiders. H-D-Pro-Phe-Arg-chloromethylketone trifluoroacetate salt binds to the cytolysin, which prevents its activity by inactivating it. The drug also has a vasoconstrictive effect, which limits blood flow to tissues and may reduce tissue damage caused by venom toxins.Formule :C21H31ClN6O3Degré de pureté :Min. 95%Masse moléculaire :450.96 g/mol3,5-Difluorobenzoic acid
CAS :3,5-Difluorobenzoic acid is a pharmaceutical preparation that has been used in the treatment of inflammatory diseases and cancer. It is an enantiomer of 5-Fluorobenzoic acid. 3,5-Difluorobenzoic acid can be synthesized from 2,4-dichlorophenoxyacetic acid by cycloaddition process with fluorine. Magnetic resonance spectroscopy has shown that 3,5-Difluorobenzoic acid binds to oxytocin receptor. The binding of 3,5-Difluorobenzoic acid to oxytocin receptor leads to the activation of its G protein coupled receptor activity. This causes an increase in intracellular cAMP levels and subsequently leads to the inhibition of bacterial enzyme ns3 protease and cardiac hypertrophy induced by chronic angiotensin II infusion.Degré de pureté :Min. 95%
![2-[(3,5,6-Trichloro-2-pyridinyl)oxy]acetic acid](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FFT28420.webp&w=3840&q=75)
