
Composés apparentés aux enzymes, aux peptides et aux protéines
Les composés liés aux enzymes, peptides et protéines sont essentiels pour étudier et manipuler les voies biochimiques. Ces composés incluent des enzymes qui catalysent les réactions biochimiques, des peptides qui servent d'hormones et de molécules de signalisation, et des protéines qui accomplissent une vaste gamme de fonctions au sein des organismes. Cette catégorie comprend des inhibiteurs, activateurs, substrats et autres réactifs indispensables pour l'enzymologie, la protéomique et la recherche sur les peptides. Chez CymitQuimica, nous proposons une sélection variée de composés de haute qualité pour faciliter vos recherches en cinétique enzymatique, fonction des protéines et synthèse des peptides, garantissant des résultats précis et fiables.
Sous-catégories appartenant à la catégorie "Composés apparentés aux enzymes, aux peptides et aux protéines"
- Acides aminés (AA)(40.493 produits)
- Enzymes(3.560 produits)
- Peptides(30.719 produits)
- Protéines(15.021 produits)
1312 produits trouvés pour "Composés apparentés aux enzymes, aux peptides et aux protéines"
Trier par
Degré de pureté (%)
0
100
|
0
|
50
|
90
|
95
|
100
(Val438)-Tyrosinase (432-444) (human) acetate salt
CAS :<p>H-SYLQDSVPDSFQD-OH peptide, corresponding to amino acids 432-444 of human Tyrosinase. The peptide is supplied as an acetate salt.</p>Formule :C65H93N15O26Degré de pureté :Min. 95%Masse moléculaire :1,500.52 g/molIntermedin-53 (human) trifluoroacetate salt
<p>Please enquire for more information about Intermedin-53 (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C247H395N83O73S3Degré de pureté :Min. 95%Masse moléculaire :5,791.49 g/molLQEQ-19 (human) trifluoroacetate salt
<p>Please enquire for more information about LQEQ-19 (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C106H170N30O34Degré de pureté :Min. 95%Masse moléculaire :2,408.67 g/molβ-Endorphin (bovine, camel, mouse)
CAS :<p>Beta-Endorphin (β-EP) is a peptide hormone that has a number of biological properties. It binds to kappa opioid receptors and affects the function of various cells in the body. β-EP is also potent inducers of pluripotent stem cells and has been shown to reduce pain and inflammation, as well as having anti-inflammatory properties. β-EP may also have some physiological effects on the brain, including increasing blood flow to the brain, affecting memory, and reducing stress levels.</p>Formule :C155H250N42O44SDegré de pureté :Min. 95%Masse moléculaire :3,437.97 g/molTyrosinase (206-214) (human) acetate salt
CAS :<p>H-AFLPWHRLF-OH peptide, corresponding to amino acids 206-214 of human Tyrosinase. The peptide is supplied as an acetate salt.</p>Formule :C61H83N15O10Degré de pureté :Min. 95%Masse moléculaire :1,186.41 g/mol(Pro34)-Peptide YY (human) trifluoroacetate salt
CAS :<p>Please enquire for more information about (Pro34)-Peptide YY (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C194H294N54O56Degré de pureté :Min. 95%Masse moléculaire :4,278.74 g/molPAR-1 (1-6) (mouse, rat) trifluoroacetate salt
CAS :<p>Please enquire for more information about PAR-1 (1-6) (mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C37H54N10O9Degré de pureté :Min. 95%Masse moléculaire :782.89 g/molAmmonium molybdate tetrahydrate - ACS
CAS :<p>Ammonium molybdate tetrahydrate (AMT) is a molybdenum compound with the chemical formula (NH4)6Mo7O24·4H2O. It is a yellow crystalline solid that is soluble in water and n-hexane. AMT has been clinically used for the treatment of Wilson's disease, an inherited disorder that causes copper to accumulate in the body. AMT binds to copper ions and prevents them from being absorbed into the bloodstream. The rate of ATP production increases when AMT is added to cells, which may be due to its effect on electron transport or because it inhibits ATPase activity.</p>Formule :(NH4)6Mo7O24•(H2O)4Degré de pureté :Min. 95%Couleur et forme :White Clear LiquidMasse moléculaire :1,236 g/molFluorogenic Human CMV Protease Substrate trifluoroacetate salt
CAS :<p>Please enquire for more information about Fluorogenic Human CMV Protease Substrate trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C73H109N23O18SDegré de pureté :Min. 95%Masse moléculaire :1,628.86 g/mol(Des-octanoyl)-Ghrelin (mouse, rat) trifluoroacetate salt
CAS :<p>Please enquire for more information about (Des-octanoyl)-Ghrelin (mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C139H231N45O41Degré de pureté :Min. 95%Masse moléculaire :3,188.6 g/molSalusin-β (human) trifluoroacetate salt
CAS :<p>Please enquire for more information about Salusin-beta (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C115H176N32O21Degré de pureté :Min. 95%Masse moléculaire :2,342.83 g/molACTH (18-39) (human)
CAS :<p>ACTH is a polypeptide hormone that regulates the release of cortisol from the adrenal cortex. ACTH (18-39) is a fragment of ACTH which binds to the glucocorticoid receptor with high affinity. The carboxy terminal sequence of ACTH (18-39) is identical to that of human ACTH and can be used as an immunogen to produce monoclonal antibodies against ACTH. The monoclonal antibodies can then be used in prognostic studies for patients with congestive heart failure, diabetic neuropathy, or k562 cells. ACTH (18-39) has an optimum pH level of 7.0 and can bind to cellular receptors at physiological concentrations. It also has a molecular weight of 4,000 Daltons and is soluble in trifluoroacetic acid and hydrogen fluoride, but not in water or methanol.</p>Formule :C112H165N27O36Degré de pureté :Min. 95%Masse moléculaire :2,465.67 g/molTIMP-2 (145-168) (human, bovine) trifluoroacetate salt
<p>Please enquire for more information about TIMP-2 (145-168) (human, bovine) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C131H189N33O35S3Degré de pureté :Min. 95%Masse moléculaire :2,882.3 g/mol(Asn10,Leu11,D-Trp12)-pTH-Related Protein (7-34) amide (human, mouse, rat)
CAS :<p>Please enquire for more information about (Asn10,Leu11,D-Trp12)-pTH-Related Protein (7-34) amide (human, mouse, rat) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C162H254N50O36Degré de pureté :Min. 95%Masse moléculaire :3,478.07 g/molDiethyl 3-hydroxyglutarate
CAS :<p>Diethyl 3-hydroxyglutarate is a chiral molecule that is used in the synthesis of pharmaceuticals. It has been shown to inhibit HMG-CoA reductase and is used as an inhibitor in drug development. Diethyl 3-hydroxyglutarate inhibits the enzyme HMG-CoA reductase, which catalyzes the conversion of HMG-CoA to mevalonic acid. This irreversible reaction provides the rate limiting step for cholesterol synthesis, and as such, inhibition of this enzyme leads to decreased levels of cholesterol in the body. The hydroxy group on diethyl 3-hydroxyglutarate can be deprotonated with a strong base such as LDA or LiHMDS to form an enolate anion that can react with electrophiles such as ketones or aldehydes to form keto esters or acetals. Diethyl 3-hydroxyglutarate also has lipase activity,</p>Formule :C9H16O5Degré de pureté :Min. 95%Masse moléculaire :204.22 g/molHepcidin-24 (human) trifluoroacetate salt
<p>Please enquire for more information about Hepcidin-24 (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C109H165N33O28S9Degré de pureté :Min. 95%Masse moléculaire :2,674.28 g/molUrocortin (human) trifluoroacetate salt
CAS :<p>Trifluoroacetate salt</p>Formule :C204H337N63O64Degré de pureté :Min. 95%Masse moléculaire :4,696.24 g/molCalcium stearate
CAS :<p>Calcium stearate is a calcium salt that is used as an emulsifier and thickener. It has been shown to have the optimum concentration for inhibiting enzymes such as phospholipase A2, which is responsible for the release of arachidonic acid from phospholipids found in cell membranes. Calcium stearate can also be used in combination with zirconium oxide or sodium salts as a drug-release system. The phase transition temperature of calcium stearate is around 100 degrees Celsius, which means it melts at this temperature. This property makes calcium stearate useful in many applications, including as a lubricant and anti-wear additive in automotive parts. Calcium stearate may also have physiological effects on the human body, such as reducing water vapor and increasing co2 flow.</p>Formule :C36H70CaO4Degré de pureté :Min. 95%Couleur et forme :White PowderMasse moléculaire :607.02 g/molCefaclor monohydrate
CAS :<p>Inhibitor of bacterial cell wall biogenesis; cephalosporin</p>Formule :C15H16ClN3O5SDegré de pureté :Min. 95 Area-%Masse moléculaire :385.82 g/molPreangiotensinogen (11-14) (human) acetate salt
CAS :<p>Please enquire for more information about Preangiotensinogen (11-14) (human) acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C21H35N7O6Degré de pureté :Min. 95%Masse moléculaire :481.55 g/molProadrenomedullin (1-20) (rat) trifluoroacetate salt
CAS :<p>Please enquire for more information about Proadrenomedullin (1-20) (rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C111H177N37O28Degré de pureté :Min. 95%Masse moléculaire :2,477.83 g/molpTH (53-84) (human)
CAS :<p>Please enquire for more information about pTH (53-84) (human) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C149H253N43O54Degré de pureté :Min. 95%Masse moléculaire :3,510.86 g/mol(Ala11,D-Leu15)-Orexin B (human) trifluoroacetate salt
CAS :<p>Please enquire for more information about (Ala11,D-Leu15)-Orexin B (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C120H206N44O35SDegré de pureté :Min. 95%Masse moléculaire :2,857.26 g/mol(Lys1015·1024)-Thrombospondin-1 (1015-1024) (human, bovine, mouse) trifluoroacetate salt
CAS :<p>Please enquire for more information about (Lys1015·1024)-Thrombospondin-1 (1015-1024) (human, bovine, mouse) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C68H105N17O12SDegré de pureté :Min. 95%Masse moléculaire :1,384.73 g/molAmyloid β/A4 Protein Precursor770 (586-595) (human, mouse, rat) trifluoroacetate salt
CAS :<p>Please enquire for more information about Amyloid beta/A4 Protein Precursor770 (586-595) (human, mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C47H73N11O16SDegré de pureté :Min. 95%Masse moléculaire :1,080.21 g/molKisspeptin-54 (27-54) (human) trifluoroacetate salt
CAS :<p>Please enquire for more information about Kisspeptin-54 (27-54) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C149H226N42O39Degré de pureté :Min. 95%Masse moléculaire :3,229.65 g/mol(Asp371)-Tyrosinase (369-377) (human) trifluoroacetate salt
CAS :<p>Trifluoroacetate salt</p>Formule :C42H66N10O16S2Degré de pureté :Min. 95%Masse moléculaire :1,031.16 g/molNeuropeptide Y (2-36) (human, rat) trifluoroacetate salt
CAS :<p>Please enquire for more information about Neuropeptide Y (2-36) (human, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C180H276N54O55SDegré de pureté :Min. 95%Masse moléculaire :4,108.51 g/molAcetyl-δ-Endorphin (bovine, camel, mouse, ovine)
CAS :<p>Please enquire for more information about Acetyl-delta-Endorphin (bovine, camel, mouse, ovine) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C138H217N35O40SDegré de pureté :Min. 95%Masse moléculaire :3,038.48 g/molPrion Protein (118-135) (human) trifluoroacetate salt
CAS :<p>Please enquire for more information about Prion Protein (118-135) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C68H112N18O22S2Degré de pureté :Min. 95%Masse moléculaire :1,597.86 g/molBig Endothelin-1 (1-31) (human, bovine) trifluoroacetate salt )
CAS :<p>Please enquire for more information about Big Endothelin-1 (1-31) (human, bovine) trifluoroacetate salt ) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C162H236N38O47S5Degré de pureté :Min. 95%Masse moléculaire :3,628.17 g/molpTH-Related Protein (1-40) (human, mouse, rat) trifluoroacetate salt
CAS :<p>Please enquire for more information about pTH-Related Protein (1-40) (human, mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C207H334N66O58Degré de pureté :Min. 95%Masse moléculaire :4,675.28 g/molPresenilin-1 (331-349)-Cys (human, mouse) trifluoroacetate salt
CAS :<p>Please enquire for more information about Presenilin-1 (331-349)-Cys (human, mouse) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C92H130N28O37SDegré de pureté :Min. 95%Masse moléculaire :2,252.25 g/mol(Ala11·22·28)-VIP (human, mouse, rat) trifluoroacetate salt
CAS :<p>(Ala11·22·28)-VIP is an endogenous peptide which is involved in the regulation of inflammation. It is a specific agonist for the vasoactive intestinal peptide receptor (VIP-R) and has been shown to exacerbate inflammatory responses such as those seen in tissues, intestines, and phagocytes. VIP also has effects on other cells types that are mediated by its ability to activate the VIP-R. These include increased vascular permeability and vasodilation, as well as increases in reactive oxygen species and cytokine production.</p>Formule :C139H231N43O39SDegré de pureté :Min. 95%Masse moléculaire :3,160.65 g/molPAR-3 (1-6) amide (human) trifluoroacetate salt
<p>Please enquire for more information about PAR-3 (1-6) amide (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C29H46N10O7Degré de pureté :Min. 95%Masse moléculaire :646.74 g/molGhrelin-Cys(BMCC-biotinyl) (human) trifluoroacetate salt
<p>Please enquire for more information about Ghrelin-Cys(BMCC-biotinyl) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C178H293N53O48S2Degré de pureté :Min. 95%Masse moléculaire :4,007.69 g/molBiotinyl-Obestatin (rat) trifluoroacetate salt
CAS :<p>Please enquire for more information about Biotinyl-Obestatin (rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C124H188N36O33SDegré de pureté :Min. 95%Masse moléculaire :2,743.11 g/molHIV Protease Substrate III
CAS :<p>HIV protease is a large protein that cleaves the polyprotein of HIV. This enzyme is essential for viral replication and so any drug that inhibits its function will inhibit HIV infectivity. The HIV protease substrate III, which contains histidine at position 3, has been used to study the effects of HIV proteases on different tissue types. It has been shown that this substrate can be detected in the cytoplasm and vacuole of cells infected with HIV, indicating that it may be involved in the transport process. The addition of an acidic amino acid (p-nitro-phenylalanine) to the substrate increases its antiviral activity by increasing its stability against proteolytic enzymes and allowing it to penetrate into cells more easily.</p>Formule :C58H95N19O16Degré de pureté :Min. 95%Masse moléculaire :1,314.49 g/molAcetyl-ACTH (4-24) (human, bovine, rat) trifluoroacetate salt
CAS :<p>Please enquire for more information about Acetyl-ACTH (4-24) (human, bovine, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C123H193N37O26SDegré de pureté :Min. 95%Masse moléculaire :2,638.15 g/molRANTES (human) trifluoroacetate salt
<p>Please enquire for more information about RANTES (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C350H534N96O100S5Degré de pureté :Min. 95%Masse moléculaire :7,846.9 g/molMAPKK2 (1-16) (human, mouse, rat)
CAS :<p>Please enquire for more information about MAPKK2 (1-16) (human, mouse, rat) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C81H144N24O19SDegré de pureté :Min. 95%Masse moléculaire :1,790.23 g/molNeuronostatin-13 (human, canine, porcine) trifluoroacetate salt
CAS :<p>Please enquire for more information about Neuronostatin-13 (human, canine, porcine) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C64H110N20O16Degré de pureté :Min. 95%Masse moléculaire :1,415.68 g/molAmyloid b-Protein (1-42) (mouse, rat)
CAS :<p>Please enquire for more information about Amyloid b-Protein (1-42) (mouse, rat) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C199H307N53O59SDegré de pureté :Min. 95%Masse moléculaire :4,417.95 g/mol5-(H-Gly-Pro-Gly-Pro-amido)-9-[di-(3-sulfonylpropyl)amino]-benzo[a]phenoxazonium perchlorate
CAS :<p>Please enquire for more information about 5-(H-Gly-Pro-Gly-Pro-amido)-9-[di-(3-sulfonylpropyl)amino]-benzo[a]phenoxazonium perchlorate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C36H42N7O11S2Degré de pureté :Min. 95%Masse moléculaire :812.89 g/molPACAP-38 (28-38) (human, chicken, mouse, ovine, porcine, rat) trifluoroacetate salt
CAS :<p>PACAP-38 (28-38) is a peptide hormone that is produced in the brain and regulates various physiological processes. It has been shown to have effects on intestinal, pancreatic, and lung cells. PACAP-38 (28-38) is a potent antagonist of vasoactive intestinal polypeptide (VIP), which has been implicated in the regulation of gastrointestinal motility and fluid secretion. The peptide also inhibits cancer cell proliferation by activating cell death pathways.</p>Formule :C61H110N24O14Degré de pureté :Min. 95%Masse moléculaire :1,403.68 g/molOsteocalcin (45-49) (human)
CAS :<p>Please enquire for more information about Osteocalcin (45-49) (human) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C30H39N5O7Degré de pureté :Min. 95%Masse moléculaire :581.66 g/molBand 3 Protein (824-829) (human)
CAS :<p>Please enquire for more information about Band 3 Protein (824-829) (human) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C37H65N11O8Degré de pureté :Min. 95%Masse moléculaire :791.98 g/molGlycerol tristearate
CAS :<p>Glycerol tristearate is a triglyceride, which is derived from the esterification of glycerol with stearic acid, a saturated fatty acid. This compound is typically sourced from natural fats and oils through a process involving the hydrogenation of vegetable oils, which facilitates its pure and controlled production.The mode of action of glycerol tristearate involves its function as an effective emulsifier. It stabilizes mixtures of water and oil by reducing interfacial tension, thus enabling the formation of stable emulsions. Its solid form at room temperature also contributes to its ability to enhance texture and stability in various formulations.Glycerol tristearate is widely used in diverse applications including the food industry, where it acts as a texturizer and stabilizer in products like margarine, chocolate, and confectionery. Additionally, it plays a significant role in the cosmetics and personal care sectors, where it improves the texture and stability of creams and lotions. Its properties make it a valuable ingredient for controlling crystallization and improving consistency across multiple industry settings.</p>Formule :C57H110O6Degré de pureté :Min. 95%Masse moléculaire :891.48 g/molSeminal Plasma Inhibin (67-94) (human)
CAS :<p>Please enquire for more information about Seminal Plasma Inhibin (67-94) (human) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C150H240N36O43S2Degré de pureté :Min. 95%Masse moléculaire :3,299.86 g/molCortistatin-17 (human) trifluoroacetate salt
CAS :<p>Please enquire for more information about Cortistatin-17 (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C96H139N27O24S3Degré de pureté :Min. 95%Masse moléculaire :2,151.5 g/molPrion Protein (106-126) (human) (scrambled) trifluoroacetate salt
CAS :<p>Please enquire for more information about Prion Protein (106-126) (human) (scrambled) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C80H138N26O24S2Degré de pureté :Min. 95%Masse moléculaire :1,912.24 g/molTyr-Leptin (26-39) (human)
CAS :<p>Please enquire for more information about Tyr-Leptin (26-39) (human) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C80H137N19O25Degré de pureté :Min. 95%Masse moléculaire :1,765.06 g/mol(p-Chloro-D-Phe6,Leu17)-VIP (human, mouse, rat) trifluoroacetate salt
CAS :<p>VIP is a potent vasoactive neuropeptide that is found in the heart, brain, and gut. It has been shown to be a potent inhibitor of guanethidine-induced contractions in the femoral vein, as well as atrial contractions. VIP also inhibits spontaneous contractions in the fundic region of the stomach and intestinal motility. VIP has been shown to inhibit vasoactive intestinal polypeptide-induced contractions in isolated rat ileum. VIP is expressed primarily in the enteric nervous system and throughout the gastrointestinal tract.</p>Formule :C148H239ClN44O42Degré de pureté :Min. 95%Masse moléculaire :3,342.21 g/molrec Leptin (human)
<p>Please enquire for more information about rec Leptin (human) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Degré de pureté :Min. 95%Cinchonine Hydrochloride Hydrate
CAS :<p>Cinchonine hydrochloride hydrate is a compound that belongs to the class of amines. It is used as an anti-malarial drug, an anti-arrhythmic agent, and a vasodilator. Cinchonine hydrochloride hydrate has been shown to be heat resistant and can be used in pharmaceutical preparations such as gel permeation chromatography. This compound also has a catalytic effect on reactions with glycerin and piperidone, which are used in the production of various dyes. Cinchonine hydrochloride hydrate can also be used as a solid catalyst for viscosity measurements in wastewater treatment plants.</p>Formule :C19H22N2O·HCl·xH2ODegré de pureté :Min. 95%Masse moléculaire :330.85 g/molSodium dimethyldithiocarbamate hydrate
CAS :<p>Sodium dimethyldithiocarbamate hydrate is a salt of dimethyldithiocarbamic acid. It is used as an additive in paints and coatings to prevent corrosion of metal. Sodium dimethyldithiocarbamate hydrate is also used in the production of polyurethane and polyester resins, where it acts as a curing agent. Dimethyldithiocarbamic acid has been shown to be a ligand for the influenza virus, inhibiting viral activity by binding to the hemagglutinin protein. The crystal system of this substance is hexagonal; its salts exist in both acidic and basic forms. The functional theory explains the stabilization of this compound through coordination with nitrogen atoms on one side and phenyl substituents on the other side. Hexamethylenetetramine reacts with sodium chloride to form sodium dimethyldithiocarbamate hydrate, which can then react with methanol or eth</p>Formule :C3H6NNaS2·xH2ODegré de pureté :Min. 95%Couleur et forme :White PowderMasse moléculaire :143.2 g/molMART-1 (27-35) (human) trifluoroacetate salt
CAS :Produit contrôlé<p>Please enquire for more information about MART-1 (27-35) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C37H67N9O11Degré de pureté :Min. 95%Masse moléculaire :813.98 g/molpTH (1-31) (human)
CAS :<p>Please enquire for more information about pTH (1-31) (human) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C162H269N49O47S2Degré de pureté :Min. 95%Masse moléculaire :3,719.3 g/molAtrial Natriuretic Factor (1-28) (human) hydrochloride salt
CAS :Produit contrôlé<p>Please enquire for more information about Atrial Natriuretic Factor (1-28) (human) hydrochloride salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C127H203N45O39S3Degré de pureté :Min. 95%Masse moléculaire :3,080.45 g/molPAR-2 (6-1) amide (mouse, rat) trifluoroacetate salt
CAS :<p>PAR-2 (6-1) amide is a proteolytic enzyme that is activated by inflammatory stimuli. It has been shown to be a major contributor to the pathogenesis of inflammatory bowel disease, and is found in neurons, the bowel, and pancreatic acinar cells. PAR-2 (6-1) amide activates proteases such as trypsin and chymotrypsin and also functions as an antimicrobial peptide. Activation of PAR-2 (6-1) amide leads to the cleavage of proteins at specific sites on their amino acid chains. This cleavage can lead to changes in protein conformation or function. PAR-2 (6-1) amide has been shown to increase endothelial cell proliferation and inhibit bacterial growth, but does not have any effect on cultured normal human skin fibroblasts.</p>Formule :C29H56N10O7Degré de pureté :Min. 95%Masse moléculaire :656.82 g/molGastric Inhibitory Polypeptide (6-30) amide (human) trifluoroacetate salt
CAS :<p>Please enquire for more information about Gastric Inhibitory Polypeptide (6-30) amide (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C139H209N35O38SDegré de pureté :Min. 95%Masse moléculaire :3,010.43 g/molFibrinopeptide A (human) trifluoroacetate salt
CAS :<p>Fibrinopeptide A is a peptide that is released from the fibrinolysis of fibrinogen. It can be used as a blood marker for the diagnosis of bowel disease and primary pulmonary hypertension, but not for other diseases such as infectious diseases. Fibrinopeptide A has been shown to be an effective model system for studying thrombin-mediated fibrin polymerization in vitro. This drug also can be used as a tool for investigating the disulfide bond in fibrinogen.</p>Formule :C63H97N19O26Degré de pureté :Min. 95%Masse moléculaire :1,536.56 g/molRenin Substrate 1 trifluoroacetate salt
CAS :<p>Please enquire for more information about Renin Substrate 1 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C109H157N31O22S2Degré de pureté :Min. 95%Masse moléculaire :2,317.74 g/molNeuromedin U-25 (human) trifluoroacetate salt
CAS :<p>Please enquire for more information about Neuromedin U-25 (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C141H203N41O38Degré de pureté :Min. 95%Masse moléculaire :3,080.37 g/molCART (55-102) (human) trifluoroacetate salt
CAS :<p>CART (55-102) is a specific amino acid that has been shown to bind to the CART receptor. It has been found in human and rat tissue, including the brain, pituitary gland, and pancreas. This compound is thought to be involved in regulating appetite and energy expenditure. The CART (55-102) trifluoroacetate salt has been shown to be active in a variety of animal models for obesity and diabetes, as well as for reducing food intake.</p>Formule :C225H365N65O65S7Degré de pureté :Min. 95%Masse moléculaire :5,245.17 g/molMonomethyl fumarate
CAS :<p>Monomethyl fumarate is a metabolite of dimethyl fumarate (DMF) and has been shown to be an inhibitor of the mitochondrial membrane potential. DMF is currently in clinical trials for the treatment of bowel disease, but its use has been limited by its poor oral bioavailability. Monomethyl fumarate has been shown to be more potent than DMF in inhibiting mitochondrial membrane potential and, therefore, may be a better therapeutic candidate for the treatment of bowel disease. Monomethyl fumarate also inhibits cell lysis through inhibition of tiglic acid production and increased resistance to autoimmune diseases.</p>Formule :C5H6O4Degré de pureté :Min. 98 Area-%Couleur et forme :White Off-White PowderMasse moléculaire :130.1 g/mol(Nle 8·18,Tyr34)-pTH (1-34) (human)
CAS :<p>Please enquire for more information about (Nle 8·18,Tyr34)-pTH (1-34) (human) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C183H295N55O52Degré de pureté :Min. 95%Masse moléculaire :4,097.64 g/molpTH-Related Protein (7-34) amide (human, mouse, rat) trifluoroacetate salt
CAS :<p>Please enquire for more information about pTH-Related Protein (7-34) amide (human, mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C153H247N49O37Degré de pureté :Min. 95%Masse moléculaire :3,364.91 g/molDefensin HNP-2 (human) trifluoroacetate salt
CAS :<p>Defensin HNP-2 is a peptide that has been shown to bind to cancer cells, metabolic disorders, and endometriosis. It also has pharmaceutical preparations for treating microbial infection and other diseases. Defensin HNP-2 is a broad-spectrum antimicrobial peptide and it binds to bacterial membranes in the cell cytoplasm. Defensin HNP-2 may be used as diagnostic agents or in the treatment of microbial infections. This antimicrobial peptide is stable when complexed with calcium ions and can be used against s. aureus strains that are resistant to antibiotics such as ciprofloxacin.</p>Formule :C147H217N43O37S6Degré de pureté :Min. 95%Masse moléculaire :3,370.96 g/molpTH (1-84) (rat) trifluoroacetate salt
<p>Please enquire for more information about pTH (1-84) (rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C406H670N122O126S3Degré de pureté :Min. 95%Masse moléculaire :9,372.61 g/mol(Tyr65,Phe67)-C5a (65-74) (human)
CAS :<p>Please enquire for more information about (Tyr65,Phe67)-C5a (65-74) (human) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C55H85N15O16SDegré de pureté :Min. 95%Masse moléculaire :1,244.42 g/molPAR-4 (1-6) amide (human) trifluoroacetate salt
CAS :<p>Please enquire for more information about PAR-4 (1-6) amide (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C28H42N8O8Degré de pureté :Min. 95%Masse moléculaire :618.68 g/molMAGE-3 Antigen (168-176) (human) acetate salt
CAS :<p>Please enquire for more information about MAGE-3 Antigen (168-176) (human) acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C48H71N11O15Degré de pureté :Min. 95%Masse moléculaire :1,042.14 g/molpTH-Related Protein (67-86) amide (human, bovine, dog, mouse, ovine, rat) trifluoroacetate salt
CAS :<p>Please enquire for more information about pTH-Related Protein (67-86) amide (human, bovine, dog, mouse, ovine, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C108H173N27O35Degré de pureté :Min. 95%Masse moléculaire :2,409.69 g/mol(D-Lys16)-ACTH (1-24) (human, bovine, rat) trifluoroacetate salt
CAS :<p>Please enquire for more information about (D-Lys16)-ACTH (1-24) (human, bovine, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C136H210N40O31SDegré de pureté :Min. 95%Masse moléculaire :2,933.44 g/molGalanin (1-19) (human)
CAS :<p>Please enquire for more information about Galanin (1-19) (human) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C89H130N26O25Degré de pureté :Min. 95%Masse moléculaire :1,964.14 g/molBig Endothelin-1 (human)
CAS :<p>Please enquire for more information about Big Endothelin-1 (human) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C189H282N48O56S5Degré de pureté :Min. 95%Masse moléculaire :4,282.88 g/molLactoferrin N-Lobe (231-245) (human)
CAS :<p>Please enquire for more information about Lactoferrin N-Lobe (231-245) (human) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C74H118N22O24S2Degré de pureté :Min. 95%Masse moléculaire :1,763.99 g/mol(Glu17·21·24)-Osteocalcin (1-49) (human) trifluoroacetate salt
<p>Please enquire for more information about (Glu17·21·24)-Osteocalcin (1-49) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C266H381N67O76S2Degré de pureté :Min. 95%Masse moléculaire :5,797.41 g/molOxazine 170perchlorate
CAS :<p>Oxazine 170perchlorate is a magnetic resonance imaging contrast agent. It has a high molecular weight and a cyclic structure consisting of two oxazine moieties connected by a chloride bridge. This molecule can be reconstituted in water or an organic solvent, such as tetrahydrofuran, to give a constant concentration of 170mg/ml. Oxazine 170perchlorate is stable in the presence of oxygen and radiation, but decomposes when heated to 200°C in the presence of dithionite. The protonation state of the molecule is pH dependent and changes with redox potential. Oxazine 170perchlorate exhibits fluorescence at 695nm when irradiated with light at 480nm and has been shown to have high relaxivity properties when used for MRI scans.</p>Formule :C21H22ClN3O5Degré de pureté :Min. 95%Masse moléculaire :431.87 g/molGLP-1 (7-36)-Lys(6-FAM) amide (human, bovine, guinea pig, mouse, rat) trifluoroacetate salt
CAS :<p>Please enquire for more information about GLP-1 (7-36)-Lys(6-FAM) amide (human, bovine, guinea pig, mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C176H248N42O52Degré de pureté :Min. 95%Masse moléculaire :3,784.1 g/molrec Leptin (mouse)
CAS :<p>Please enquire for more information about rec Leptin (mouse) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Degré de pureté :Min. 95%Biotinyl-Neuropeptide W-23 (human) trifluoroacetate salt
CAS :<p>Please enquire for more information about Biotinyl-Neuropeptide W-23 (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C129H197N37O30S2Degré de pureté :Min. 95%Masse moléculaire :2,810.31 g/molNeuropeptide S (rat) trifluoroacetate salt
CAS :<p>Please enquire for more information about Neuropeptide S (rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C95H160N34O27Degré de pureté :Min. 95%Masse moléculaire :2,210.5 g/mol(Nle 13,Glu14)-Motilin (human, porcine) trifluoroacetate salt
CAS :<p>Please enquire for more information about (Nle 13,Glu14)-Motilin (human, porcine) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C121H189N33O36Degré de pureté :Min. 95%Masse moléculaire :2,682 g/molAmylin (human) trifluoroacetate salt
CAS :<p>Amylin is a hormone that regulates the release of insulin from the pancreas. Amylin is a protein that consists of 39 amino acids, and in its natural form it is not soluble in water. The amyloid fibrils are insoluble aggregates of proteins that can be found in the brain tissue of patients with Alzheimer's disease. Amylin has been shown to have an entrapment efficiency greater than 96% by using polymeric particles with a diameter less than 50 microns. These particles are able to increase water solubility and nutrient metabolism, as well as improve evaporation rates. They also provide an increased surface area for absorption and pharmacological properties. Amylin has been shown to lower postprandial glycemia when used with insulin in type II diabetes mellitus patients, and may also be an anorectic agent.</p>Formule :C165H261N51O55S2Degré de pureté :Min. 95%Masse moléculaire :3,903.28 g/molNeuromedin U-23 (rat) trifluoroacetate salt
CAS :<p>Neuromedin U-23 (rat) is a peptide that belongs to the family of tachykinins, which are small neuropeptides that act as neurotransmitters in the central nervous system. It is a potent stimulator of intestinal motility and has been shown to have protective effects against oxidative stress in cells. Neuromedin U-23 (rat) shares sequence similarity with human neuromedin N-19 and binds to the same receptors in the brain, suggesting it may have similar physiological effects. This peptide has been shown to inhibit tumor cell growth by inducing apoptosis, but it does not appear to have any effect on healthy cells.</p>Formule :C124H180N34O31Degré de pureté :Min. 95%Masse moléculaire :2,642.97 g/molKisspeptin-13 (human) trifluoroacetate salt
CAS :<p>Please enquire for more information about Kisspeptin-13 (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C78H107N21O18Degré de pureté :Min. 95%Masse moléculaire :1,626.81 g/molPAR-4 (1-6) (human) trifluoroacetate salt
CAS :<p>Please enquire for more information about PAR-4 (1-6) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C28H41N7O9Degré de pureté :Min. 95%Masse moléculaire :619.67 g/molSodium stearate
CAS :<p>Sodium stearate is a sodium salt that is commonly used as a surfactant and emulsifying agent in the food industry. The drug interactions with sodium stearate are not well known, but it has been shown to have an effect on fetal bovine serum (FBS) cell viability at concentrations above 10%. Sodium stearate typically shows a thermal expansion of 5–6% per degree Celsius. It is also used in conjunction with CO2 flow to produce anhydrous sodium carbonate and sodium bicarbonate. Sodium stearate can be found in foods such as margarine, shortening, and baking powder. It also has metabolic effects such as promoting the production of insulin and reducing blood sugar levels. It has also been shown to inhibit tumor growth in bone cancer cell lines.</p>Formule :C18H35NaO2Degré de pureté :Min. 95%Couleur et forme :White/Off-White SolidMasse moléculaire :306.46 g/mol...(Ala13)-Apelin-13 (human, bovine, mouse, rat) trifluoroacetate salt
CAS :<p>Apelin-13 is a peptide hormone that is involved in the regulation of cardiovascular, respiratory and gastrointestinal functions. It has been shown to stimulate receptor activity and pain sensitivity in animal models. Apelin-13 has been shown to act as an opioid receptor agonist, meaning that it binds to the opioid receptors and activates them. This activation leads to an increase in the production of growth factors and matrix metalloproteinases, which are proteins that break down collagen and other substances in the body. The increased production of these substances can lead to inflammation and tissue destruction. Apelin-13 also interacts with several other receptors including CB2 (a cannabinoid receptor), GPCR (a G protein-coupled receptor), CRHR1 (a corticotropin releasing hormone receptor 1) and Naloxone (an opioid antagonist).</p>Formule :C63H107N23O16S·xC2HF3O2Degré de pureté :Min. 95%Masse moléculaire :1,474.74 g/mol(Leu15)-Gastrin I (human)
CAS :<p>Gastrin I (human) Pyr-Gly-Pro-Trp-Leu-Glu-Glu-Glu-Glu-Glu-Ala-Tyr-Gly-Trp-Leu-Asp, is a peptide that belongs to the family of cholecystokinin. It is synthesized by solid phase synthesis on a carboxyl group with an efficiency of more than 95%. Gastrin I (human) Pyr-Gly-Pro-Trp... has been shown to be selective towards amide bond cleavage and has high yield. It is also stable in acidic conditions and can be detritylated with phenoxy.</p>Formule :C98H126N20O31Degré de pureté :Min. 95%Masse moléculaire :2,080.17 g/molVIP sulfoxide (human, mouse, rat) trifluoroacetate salt
CAS :<p>Please enquire for more information about VIP sulfoxide (human, mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C147H238N44O43SDegré de pureté :Min. 95%Masse moléculaire :3,341.8 g/molNeuroendocrine Regulatory Peptide-1 (human) trifluoroacetate salt
CAS :<p>Please enquire for more information about Neuroendocrine Regulatory Peptide-1 (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C113H192N36O39Degré de pureté :Min. 95%Masse moléculaire :2,678.95 g/molCRF (6-33) (human, rat)
CAS :<p>CRF (6-33) is a neuropeptide that is found in the human cerebral cortex and rat liver. It has been shown to inhibit protein synthesis and sequenced by Edmond H. Fischer, who also discovered corticotropin-releasing factor (CRF). CRF (6-33) binds to its receptor CRFR1, which activates phospholipase C and generates inositol 1,4,5-triphosphate. This leads to the release of calcium from intracellular stores and the activation of protein kinase C. The release of calcium ions into the cytosol causes an increase in intracellular levels of cAMP, which activates a series of reactions responsible for the cellular effects of CRF. CRF (6-33) has been shown to be involved in depression by controlling neurotransmitter levels.br></p>Formule :C141H231N41O43SDegré de pureté :Min. 95%Masse moléculaire :3,220.66 g/molGLP-1 (1-37) (human, bovine, guinea pig, mouse, rat) trifluoroacetate salt
CAS :<p>GLP-1 (1-37) (human, bovine, guinea pig, mouse, rat) trifluoroacetate salt is a posttranslational modification of the endogenous human hormone GLP-1. It is a synthetic form of this hormone that has been modified to allow for improved stability and solubility. This peptide is found in the pancreatic alpha cells and intestinal L cells and stimulates the release of insulin from pancreatic beta cells. GLP-1 (1-37) (human, bovine, guinea pig, mouse, rat) trifluoroacetate salt has also been shown to increase glucose uptake by muscle tissue as well as stimulate the release of incretin hormones such as glucagon-like peptide 1 and gastric inhibitory polypeptide. GLP-1 (1-37) (human, bovine, guinea pig, mouse, rat) trifluoroacetate salt</p>Formule :C186H275N51O59Degré de pureté :Min. 95%Masse moléculaire :4,169.48 g/molCobalt sulfate heptahydrate
CAS :<p>Cobalt sulfate heptahydrate is an inorganic compound that is used as a pigment and a catalyst. It has been shown to be carcinogenic in vivo and in vitro. Cobalt sulfate heptahydrate appears to have carcinogenic activity, producing high values in the electrochemical impedance spectroscopy (EIS) spectrum of human serum. The carcinogenicity of cobalt sulfate heptahydrate was demonstrated by the induction of liver tumors in rats and mice, with no evidence of a threshold dose.</p>Formule :CoSO4•(H2O)7Degré de pureté :Min. 95%Couleur et forme :PowderMasse moléculaire :281.1 g/molPrepro VIP (81-122) (human) trifluoroacetate salt
CAS :<p>Please enquire for more information about Prepro VIP (81-122) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C202H325N53O64SDegré de pureté :Min. 95%Masse moléculaire :4,552.13 g/molBNP-32 (human) hydrochloride
CAS :<p>BNP-32 is a peptide hormone that regulates the volume of blood in the heart and lungs. It is used to diagnose congestive heart failure, and also as a treatment for decompensated congestive heart failure. When given as an intravenous infusion, BNP-32 reduces the levels of natriuretic peptides in the blood stream by increasing their breakdown in the kidneys. The disulfide bond between cysteine residues (Cys-Cys) is essential for its activity. BNP-32 has been shown to be effective against infectious diseases such as HIV, hepatitis C, and tuberculosis. It is also used in combination with other drugs to treat high blood pressure. This drug can be administered orally or intravenously and is biocompatible with human tissue because it is chemically stable and non-toxic at therapeutic doses.</p>Formule :C143H244N50O42S4Degré de pureté :Min. 95%Masse moléculaire :3,464.04 g/molNesfatin-1 (30-59) (mouse, rat) trifluoroacetate salt
<p>Please enquire for more information about Nesfatin-1 (30-59) (mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C167H260N40O54Degré de pureté :Min. 95%Masse moléculaire :3,692.09 g/molOrphan GPCR SP9155 Agonist P550 (mouse) trifluoroacetate salt
CAS :<p>Please enquire for more information about Orphan GPCR SP9155 Agonist P550 (mouse) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C126H195N37O37Degré de pureté :Min. 95%Masse moléculaire :2,820.12 g/molGRF (human) acetate salt
CAS :<p>Growth hormone-releasing factor (GRF) or GHRH (growth hormone-releasing hormone).Binds to the growth hormone-releasing hormone receptor (GHRH-R), causing growth hormone secretion.porcine: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGERNQEQGARVRL-NH2bovine: H-YADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2ovine: H-YADAIFTNSYRKILGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2human: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2</p>Formule :C215H358N72O66SDegré de pureté :Min. 98 Area-%Couleur et forme :PowderMasse moléculaire :5,039.65 g/molPACAP-38 (human, mouse, ovine, porcine, rat) trifluoroacetate salt
CAS :<p>PACAP-38 is a peptide that has been shown to have a variety of physiological effects, including the regulation of brain functions and immunological responses. PACAP-38 has been found to bind to toll-like receptor 4 (TLR4) in macrophages and neutrophils, which stimulates the production of proinflammatory cytokines. It also interacts with adenylate cyclase, which leads to an increase in cAMP levels. This may be the mechanism by which PACAP-38 regulates brain functions. The biological function of PACAP-38 is not yet clear but it may act as a signal peptide, regulating protein synthesis and gene expression.</p>Formule :C203H331N63O53SDegré de pureté :Min. 95%Masse moléculaire :4,534.26 g/mol(Hyp 474·477,Gln479)-cyclo-a-Fetoprotein (471-479) (human, lowland gorilla)
CAS :<p>Please enquire for more information about (Hyp 474·477,Gln479)-cyclo-a-Fetoprotein (471-479) (human, lowland gorilla) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C40H63N11O16SDegré de pureté :Min. 95%Masse moléculaire :986.06 g/mol(D-Pro194)-IL-1β (193-195) (human)
CAS :<p>IL-1beta is a pro-inflammatory cytokine that belongs to the group of interleukins. It is synthesized as a preproprotein which undergoes proteolytic processing to produce a mature 34 kDa protein with an N-terminal lys-pro sequence. IL-1beta has been shown to induce allergic reactions in animals and humans, constrictions in airways, and antigen presentation by antigen presenting cells, such as macrophages and dendritic cells. This cytokine also has costimulatory effects on immune responses and has been shown to be involved in autoimmune diseases and inflammatory diseases. The IL-1beta gene contains a hydroxyl group at the COOH terminus that allows for the formation of an aspirin binding site.</p>Formule :C15H28N4O5Degré de pureté :Min. 95%Masse moléculaire :344.41 g/molAdrenomedullin (rat) trifluoroacetate salt
CAS :<p>Please enquire for more information about Adrenomedullin (rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C242H381N77O75S5Degré de pureté :Min. 95%Masse moléculaire :5,729.42 g/molPACAP-38 (31-38) (human, chicken, mouse, ovine, porcine, rat) trifluoroacetate salt
CAS :<p>Please enquire for more information about PACAP-38 (31-38) (human, chicken, mouse, ovine, porcine, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C47H83N17O11Degré de pureté :Min. 95%Masse moléculaire :1,062.27 g/mol(Des-octanoyl)-Ghrelin (human) trifluoroacetate salt
CAS :<p>Trifluoroacetate salt</p>Formule :C141H235N47O41Degré de pureté :Min. 95%Masse moléculaire :3,244.67 g/mol(Tyr0)-Atriopeptin II (rat)
CAS :<p>Please enquire for more information about (Tyr0)-Atriopeptin II (rat) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C107H165N35O34S2Degré de pureté :Min. 95%Masse moléculaire :2,549.8 g/mol(Pyr 16)-VIP (16-28) (human, mouse, rat)
CAS :<p>Please enquire for more information about (Pyr 16)-VIP (16-28) (human, mouse, rat) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C68H114N18O18SDegré de pureté :Min. 95%Masse moléculaire :1,503.81 g/molBiotinyl-Atrial Natriuretic Factor (1-28) (human) trifluoroacetate salt
CAS :<p>Please enquire for more information about Biotinyl-Atrial Natriuretic Factor (1-28) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C137H217N47O41S4Degré de pureté :Min. 95%Masse moléculaire :3,306.75 g/molN,N'-Dimethyl-2,7-Diazapyrenium bistetrafluoroborate
CAS :<p>Please enquire for more information about N,N'-Dimethyl-2,7-Diazapyrenium bistetrafluoroborate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C16H14B2F8N2Degré de pureté :Min. 95%Masse moléculaire :407.91 g/molNeuromedin S (rat) trifluoroacetate salt
CAS :<p>Please enquire for more information about Neuromedin S (rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C193H307N57O49SDegré de pureté :Min. 95%Masse moléculaire :4,241.92 g/molProkineticin 2 Isoform 2 (human) trifluoroacetate salt
CAS :<p>Prokineticin-2 is a protein that is encoded by the PROK2 gene. It has been shown to inhibit VEGF in vitro and to be anti-inflammatory. Prokineticin-2 binds to the receptor for colony stimulating factor 1 (CSF1) and promotes angiogenesis by inducing the production of angiogenic factors such as vascular endothelial growth factor (VEGF), erythropoietin, and granulocyte macrophage colony stimulating factor (GM-CSF). It also inhibits transcriptional regulation of genes involved in inflammation, including IL-10, which inhibits IL-12 production.</p>Formule :C379H606N114O101S13Degré de pureté :Min. 95%Masse moléculaire :8,792.43 g/molBismuth citrate
CAS :<p>Bismuth citrate is an antimicrobial agent that is used to treat helicobacter pylori infections. Bismuth citrate may be an alternative to clarithromycin and metronidazole for the treatment of antibiotic-resistant strains of helicobacter. It has been shown to improve duodenal ulcer healing and reduce the incidence of gastric ulcers in a group of patients with duodenal ulcer disease. This drug has also been shown to significantly reduce the incidence of gastric cancer in patients with Helicobacter pylori infection. Bismuth citrate is a polymeric compound that is thought to bind to the bacterial cell wall and inhibit its growth through inhibition of protein synthesis, but this mechanism is not well understood. Bismuth citrate has been used as an antacid for decades, but it does not have any anti-inflammatory properties and should not be used for this purpose.</p>Formule :C6H5BiO7Degré de pureté :Min. 95%Couleur et forme :PowderMasse moléculaire :398.08 g/molHemokinin 1 (human) trifluoroacetate salt
CAS :<p>Hemokinin-1 is a hematopoietic cell growth factor that belongs to the group of neuropeptides. This protein has been shown to stimulate the production of white blood cells and is used as an adjuvant in vaccines. Hemokinin-1 stimulates the production of inflammatory cytokines and other proinflammatory substances. It also has been found to be involved in autoimmune diseases, cancer, and infectious diseases. The antigen binding site on Hemokinin-1 is located at residues Thr-Gly-Lys-Ala-Ser-Gln-Phe-Phe-Gly-Leu (TGLKSGPFGL) and the receptor binding site at residues Met-NH2. The receptor for Hemokinin 1 is the neurokinin 1 receptor (NK1R).</p>Formule :C54H84N14O14SDegré de pureté :Min. 95%Masse moléculaire :1,185.4 g/molNeuroendocrine Regulatory Peptide-1 (rat) trifluoroacetate salt
CAS :<p>Please enquire for more information about Neuroendocrine Regulatory Peptide-1 (rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C110H180N32O38Degré de pureté :Min. 95%Masse moléculaire :2,558.8 g/mol(β-Asp3)-VIP (human, mouse, rat) trifluoroacetate salt
CAS :<p>Please enquire for more information about (Beta-Asp3)-VIP (human, mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C147H238N44O42SDegré de pureté :Min. 95%Masse moléculaire :3,325.8 g/molDiethyl 3-oxoglutarate
CAS :<p>Diethyl 3-oxoglutarate is a sodium salt of a diethyl ester of malonic acid. It has been shown to be cytotoxic in vitro and in vivo, but its mechanism of action is not well understood. Diethyl 3-oxoglutarate may be involved in the production of reactive oxygen species and the induction of DNA damage by alkylating DNA. The compound has also been shown to have anti-inflammatory properties, which may be due to its ability to inhibit the production of prostaglandins.</p>Formule :C9H14O5Degré de pureté :Min. 95%Masse moléculaire :202.2 g/molACTH (7-38) (human)
CAS :<p>ACTH is a hormone that is produced by the anterior lobe of the pituitary gland. It stimulates the release of cortisol from the adrenal cortex. ACTH (7-38) has been shown to have cytosolic Ca2+ channel-blocking and antimicrobial activities, as well as an effect on defensin production in human neutrophils. ACTH (7-38) also has been shown to inhibit cytokine production in rat astrocytes, and to stimulate prostaglandin synthesis in mouse fibroblasts. This peptide also has been shown to have physiological effects on bowel disease and inflammatory bowel disease.</p>Formule :C167H257N47O46Degré de pureté :Min. 95%Masse moléculaire :3,659.12 g/mol(Tyr27)-α-CGRP (27-37) (canine, mouse, rat)
CAS :<p>Please enquire for more information about (Tyr27)-alpha-CGRP (27-37) (canine, mouse, rat) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C54H79N13O17Degré de pureté :Min. 95%Masse moléculaire :1,182.28 g/mol(Tyr0)-BNP-32 (human) trifluoroacetate salt
CAS :<p>Please enquire for more information about (Tyr0)-BNP-32 (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C152H253N51O44S4Degré de pureté :Min. 95%Masse moléculaire :3,627.22 g/moluPAR (84-95) (human) trifluoroacetate salt
CAS :<p>Please enquire for more information about uPAR (84-95) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C62H98N18O20SDegré de pureté :Min. 95%Masse moléculaire :1,447.62 g/molAdrenomedullin (11-50) (rat)
CAS :<p>Please enquire for more information about Adrenomedullin (11-50) (rat) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C194H304N58O59S4Degré de pureté :Min. 95%Masse moléculaire :4,521.11 g/molAmylin (mouse, rat) trifluoroacetate salt
CAS :<p>Trifluoroacetate salt</p>Formule :C167H272N52O53S2Degré de pureté :Min. 95%Masse moléculaire :3,920.4 g/mol(Des-Glu5)-ACTH (1-24) (human, bovine, rat) trifluoroacetate salt
CAS :<p>Please enquire for more information about (Des-Glu5)-ACTH (1-24) (human, bovine, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C131H203N39O28SDegré de pureté :Min. 95%Masse moléculaire :2,804.33 g/molβ-CGRP (human)
CAS :<p>Please enquire for more information about Beta-CGRP (human) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C162H267N51O48S3Degré de pureté :Min. 95%Masse moléculaire :3,793.37 g/mol(Nle 8·21,Tyr34)-pTH (1-34) amide (rat)
CAS :<p>Please enquire for more information about (Nle 8·21,Tyr34)-pTH (1-34) amide (rat) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C182H296N56O48Degré de pureté :Min. 95%Masse moléculaire :4,036.65 g/molAtriopeptin I (rat)
CAS :<p>Atriopeptin I is a peptide hormone that is produced in the rat mesenteric gland. It has been shown to have β-amino acid, diagnostic agents, ph optimum, and receptor activity. Atriopeptin I has been found to have atrial natriuretic effects and may be useful for the treatment of infectious diseases. Atriopeptin I has also been shown to bind with a monoclonal antibody and enzyme inhibitors as well as having a disulfide bond. The biological function of this peptide hormone is not yet known, but it is thought to be involved in fatty acid metabolism.</p>Formule :C83H135N29O30S2Degré de pureté :Min. 95%Masse moléculaire :2,083.27 g/molTetraethylammonium tetrafluoroborate
CAS :<p>Tetraethylammonium tetrafluoroborate is a diamagnetic chemical species that reacts with water, forming the hydrated salt tetraethylammonium hydroxide. Tetraethylammonium tetrafluoroborate has a high resistance to oxidation and reduction reactions. It can be used as an electrolyte in electrochemistry and as a thermal expansion agent in plastics. The potentials of this substance are around +1 V, which makes it useful for electrochemical impedance spectroscopy. Tetraethylammonium tetrafluoroborate is activated by organic solvents, but not by water vapor.</p>Formule :C8H20N·BF4Couleur et forme :White Off-White PowderMasse moléculaire :217.06 g/mol([13C6]Leu5)-Ghrelin (human) trifluoroacetate salt
CAS :<p>Please enquire for more information about ([13C6]Leu5)-Ghrelin (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Degré de pureté :Min. 95%Galanin-Like Peptide (human) trifluoroacetate salt
CAS :<p>Please enquire for more information about Galanin-Like Peptide (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C292H451N83O84SDegré de pureté :Min. 95%Masse moléculaire :6,500.28 g/molα-CGRP (19-37) (human)
CAS :<p>Please enquire for more information about Alpha-CGRP (19-37) (human) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C86H137N25O25Degré de pureté :Min. 95%Masse moléculaire :1,921.16 g/molPeptide YY (13-36) (canine, mouse, porcine, rat) trifluoroacetate salt
CAS :<p>Please enquire for more information about Peptide YY (13-36) (canine, mouse, porcine, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C135H209N41O38Degré de pureté :Min. 95%Masse moléculaire :3,014.36 g/molOrotic acid hydrate
CAS :<p>Orotic acid hydrate is a synthetic compound that is designed to be a growth regulator. Orotic acid hydrate is synthesized by reacting the orotate with pyridoxine hydrochloride, followed by crystallizing the product. Hydrogen bonds form between the water molecules and fatty acids in the crystals of OA hydrate. These hydrogen bonds stabilize the crystal structure and allow for its use as a growth regulator. The stability of this molecule can also be attributed to its ability to form hydrogen bonds with other molecules such as α-tocopherol, calcium carbonate, and synthetic cannabinoids. Orotic acid hydrate has been shown to have an effect on cancer cells because it reacts with daunorubicin in solution and inhibits DNA synthesis, inhibiting cell growth.</p>Formule :C5H4N2O4·H2ODegré de pureté :Min. 95 Area-%Couleur et forme :PowderMasse moléculaire :174.11 g/molPneumadin (human)
CAS :<p>Please enquire for more information about Pneumadin (human) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C41H70N12O14Degré de pureté :Min. 95%Masse moléculaire :955.07 g/molMonocyte Chemotactic Protein-1 (human) acetate salt
CAS :<p>Please enquire for more information about Monocyte Chemotactic Protein-1 (human) acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C379H610N108O114S5Degré de pureté :Min. 95%Masse moléculaire :8,663.89 g/molApelin-12 (human, bovine, mouse, rat)
CAS :<p>Apelin-12 is a peptide hormone that belongs to the group of apelin family. It is an endogenous agonist for the apelin receptor and has been shown to affect metabolic and cardiovascular regulation. Apelin-12 has been found to increase systolic blood pressure, which may be due to its ability to inhibit the synthesis of nitric oxide in the heart. It also exhibits anti-inflammatory properties, which have been shown in vivo using a model of colitis induced by dextran sulfate sodium (DSS). The biological properties of this hormone are not yet fully understood. However, it is known that it has effects on cardiac contractility and myocardial infarct size in vivo. Further investigation into this protein's role in inflammatory diseases and metabolic disorders may lead to new treatments for these conditions.</p>Formule :C64H103N21O14SDegré de pureté :Min. 95%Masse moléculaire :1,422.7 g/molpTH (18-48) (human)
CAS :<p>Please enquire for more information about pTH (18-48) (human) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C156H251N47O43SDegré de pureté :Min. 95%Masse moléculaire :3,505.02 g/mol(Des-His1,Glu9)-Glucagon (1-29) amide (human, rat, porcine)
CAS :<p>Please enquire for more information about (Des-His1,Glu9)-Glucagon (1-29) amide (human, rat, porcine) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C148H221N41O47SDegré de pureté :Min. 95%Masse moléculaire :3,358.65 g/molIntermedin (rat) trifluoroacetate salt
CAS :<p>Please enquire for more information about Intermedin (rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C226H361N75O64S2Degré de pureté :Min. 95%Masse moléculaire :5,216.88 g/molGalanin (1-16) (mouse, porcine, rat)
CAS :<p>Please enquire for more information about Galanin (1-16) (mouse, porcine, rat) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C78H116N20O21Degré de pureté :Min. 95%Masse moléculaire :1,669.88 g/molUroguanylin Topoisomer B (human) trifluoroacetate salt
<p>Please enquire for more information about Uroguanylin Topoisomer B (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C64H102N18O26S4Degré de pureté :Min. 95%Masse moléculaire :1,667.86 g/mol(Leu31,Pro34)-Neuropeptide Y (human, rat) trifluoroacetate salt
CAS :<p>Please enquire for more information about (Leu31,Pro34)-Neuropeptide Y (human, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C189H284N54O56SDegré de pureté :Min. 95%Masse moléculaire :4,240.67 g/molSodium potassium tartrate tetrahydrate
CAS :<p>Sodium potassium tartrate tetrahydrate is a crystal compound made up of potassium and sodium. It is a ferroelectric material that exhibits polarization and piezoelectric properties. The growth rate of these crystals can be controlled by using inhibitors such as protein kinase inhibitors. Sodium potassium tartrate tetrahydrate has been shown to have inhibitory activity against certain enzymes, including proteases and kinases. Additionally, it exhibits dielectric properties and can be used in the production of capacitors and other electronic components.</p>Formule :C4H4KNaO6·4H2ODegré de pureté :Min. 95%Couleur et forme :White PowderMasse moléculaire :282.22 g/molAmylin (8-37) (human) trifluoroacetate salt
CAS :<p>Please enquire for more information about Amylin (8-37) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C138H216N42O45Degré de pureté :Min. 95%Masse moléculaire :3,183.45 g/molMinigastrin I tifluoroacetic acid
CAS :<p>Please enquire for more information about Minigastrin I tifluoroacetic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C74H99N15O26S•(CF3CO2H)xDegré de pureté :Min. 95%Masse moléculaire :1,646.73 g/mol(Tyr38,Phe42·46)-Osteocalcin (38-49) (human)
CAS :<p>Please enquire for more information about (Tyr38,Phe42·46)-Osteocalcin (38-49) (human) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C73H101N19O17Degré de pureté :Min. 95%Masse moléculaire :1,516.7 g/mol([13C6]Leu6)-Endothelin-1 (human, bovine, dog, mouse, porcine, rat) acetate salt
<p>Please enquire for more information about ([13C6]Leu6)-Endothelin-1 (human, bovine, dog, mouse, porcine, rat) acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Degré de pureté :Min. 95%pTH-Related Protein (1-16) (human, mouse, rat)
CAS :<p>Please enquire for more information about pTH-Related Protein (1-16) (human, mouse, rat) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C77H128N24O25Degré de pureté :Min. 95%Masse moléculaire :1,789.99 g/molNeuropeptide S (1-10) (human) trifluoroacetate salt
CAS :<p>Please enquire for more information about Neuropeptide S (1-10) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C42H68N14O14SDegré de pureté :Min. 95%Masse moléculaire :1,025.14 g/molFibrinopeptide B (human) trifluoroacetate salt
CAS :<p>Fibrinopeptide B is a fibrinogen-derived peptide that has shown to inhibit the growth of HL-60 cells. It may be active as a receptor antagonist for thrombin and caproic acid. Fibrinopeptide B also inhibits angiogenesis by inhibiting the binding of acidic, basic proteins to the vascular endothelium in atherosclerotic lesions. The biological sample can be obtained from human serum or plasma.</p>Formule :C66H93N19O25Degré de pureté :Min. 95%Masse moléculaire :1,552.56 g/molEndothelin-1 (human, bovine, dog, mouse, porcine, rat) trifluoroacetate salt
CAS :<p>Please enquire for more information about Endothelin-1 (human, bovine, dog, mouse, porcine, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C109H159N25O32S5·C2HF3O2Degré de pureté :Min. 95%Masse moléculaire :2,605.93 g/molTyr-Proinsulin C-Peptide (55-89) (human)
CAS :<p>Please enquire for more information about Tyr-Proinsulin C-Peptide (55-89) (human) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C162H268N50O54Degré de pureté :Min. 95%Masse moléculaire :3,780.17 g/molMCH-Gene-Overprinted-Polypeptide-27 (rat)
CAS :<p>Please enquire for more information about MCH-Gene-Overprinted-Polypeptide-27 (rat) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C145H227N39O40S4Degré de pureté :Min. 95%Masse moléculaire :3,284.86 g/molpTH (2-38) (human) acetate salt
CAS :<p>Please enquire for more information about pTH (2-38) (human) acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C194H314N58O53S2Degré de pureté :Min. 95%Masse moléculaire :4,371.06 g/molIL-1β (163-171) (human) trifluoroacetate salt
CAS :<p>Interleukin-1 beta (IL-1β) is a cytokine that is produced by activated macrophages and T cells. It is an important regulator of immune function, inducing fever, activating the inflammatory response, and increasing vascular permeability. IL-1β is a 163-amino acid polypeptide with a molecular weight of 18.7 kDa. The trifluoroacetate salt of IL-1β has been shown to be active in vitro against human leukemic cells and to have an interferon-gamma activity in vitro.</p>Formule :C39H64N12O19Degré de pureté :Min. 95%Masse moléculaire :1,004.99 g/mol(Tyr0)-C-Type Natriuretic Peptide (32-53) (human, porcine, rat)
CAS :<p>Please enquire for more information about (Tyr0)-C-Type Natriuretic Peptide (32-53) (human, porcine, rat) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C102H166N28O30S3Degré de pureté :Min. 95%Masse moléculaire :2,360.78 g/molPAR-4 (1-6) amide (mouse) trifluoroacetate salt
CAS :<p>PAR-4 (1-6) amide (mouse) trifluoroacetate salt H-Gly-Tyr-Pro-Gly-Lys-Phe-NH2 trifluoroacetate salt is a guanine nucleotide binding protein that belongs to the PAR family of proteins. It is expressed in wild type mice and binds to the cytosolic calcium, which regulates polymerase chain reaction. PAR-4 (1-6) amide (mouse) trifluoroacetate salt H-Gly-Tyr-Pro-Gly-Lys-Phe NH2 trifluoroacetate salt can be used as a potential drug target for epidermal growth factor. It has been shown to activate transcription polymerase chain and transcriptase polymerase chain during transcriptional regulation of messenger RNA.</p>Formule :C33H46N8O7Degré de pureté :Min. 95%Masse moléculaire :666.77 g/molNeuropeptide Y (human, rat) trifluoroacetate salt
CAS :<p>Please enquire for more information about Neuropeptide Y (human, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C189H285N55O57SDegré de pureté :Min. 95%Masse moléculaire :4,271.69 g/molAsn-Ala-Intercellular Adhesion Molecule 1 (1-21) (human)
CAS :<p>Please enquire for more information about Asn-Ala-Intercellular Adhesion Molecule 1 (1-21) (human) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C99H173N29O32SDegré de pureté :Min. 95%Masse moléculaire :2,313.68 g/molTLQP-21 (mouse, rat) trifluoroacetate salt
CAS :<p>Please enquire for more information about TLQP-21 (mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C107H170N40O26Degré de pureté :Min. 95%Masse moléculaire :2,432.75 g/molβ-MSH (human) trifluoroacetate salt
CAS :<p>Beta-MSH is a hormone that belongs to the peptide hormones group. It is synthesized in the pituitary gland and released in response to stress, trauma or injury. Beta-MSH has been shown to regulate many physiological functions, including adrenocorticotrophic hormone (ACTH) secretion, skin pigmentation and regulation of body temperature. Beta-MSH also has diagnostic applications as it can be used to measure levels of this hormone in cerebrospinal fluid (CSF). The n-terminal prohormone fragment of beta-MSH can be measured by radioimmunoassay (RIA) or enzyme immunoassay (EIA), while the c-terminal prohormone fragment can be measured by RIA.</p>Formule :C118H174N34O35SDegré de pureté :Min. 95%Masse moléculaire :2,660.92 g/molpTH (1-37) (human) trifluoroacetate salt
CAS :<p>Please enquire for more information about pTH (1-37) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C195H316N58O54S2Degré de pureté :Min. 95%Masse moléculaire :4,401.09 g/molGLP-1 (1-36) amide (human, bovine, guinea pig, mouse, rat) trifluoroacetate salt
CAS :<p>Please enquire for more information about GLP-1 (1-36) amide (human, bovine, guinea pig, mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C184H273N51O57Degré de pureté :Min. 95%Masse moléculaire :4,111.45 g/molpTH (1-34) (rat)
CAS :<p>Please enquire for more information about pTH (1-34) (rat) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C180H291N55O48S2Degré de pureté :Min. 95%Masse moléculaire :4,057.71 g/molProlactin-Releasing Peptide (12-31) (human)
CAS :<p>Please enquire for more information about Prolactin-Releasing Peptide (12-31) (human) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C104H158N32O26Degré de pureté :Min. 95%Masse moléculaire :2,272.57 g/molPancreatic Polypeptide (1-17)-(Ala31, Aib 32)-Neuropeptide Y (18-36) (human) trifluoroacetate salt
CAS :<p>Please enquire for more information about Pancreatic Polypeptide (1-17)-(Ala31, Aib 32)-Neuropeptide Y (18-36) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C189H287N55O53SDegré de pureté :Min. 95%Masse moléculaire :4,209.71 g/molHIV Protease Substrate VII
CAS :<p>Please enquire for more information about HIV Protease Substrate VII including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C52H81N15O14Degré de pureté :Min. 95%Masse moléculaire :1,140.29 g/molFGF basic (1-24) (human, bovine)
CAS :<p>Please enquire for more information about FGF basic (1-24) (human, bovine) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C118H173N31O33Degré de pureté :Min. 95%Masse moléculaire :2,553.83 g/molGalanin (mouse, rat)
CAS :<p>Structure/Function: mouse, rat</p>Formule :C141H211N43O41Degré de pureté :Min. 95%Masse moléculaire :3,164.45 g/molPiperazine citrate
CAS :<p>Please enquire for more information about Piperazine citrate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :(C4H10N2)3·(C6H8O7)2Degré de pureté :Min. 95%Couleur et forme :PowderMasse moléculaire :642.65 g/molC-Type Natriuretic Peptide (1-53) (human) acetate salt
CAS :<p>Acetate salt</p>Formule :C251H417N81O71S3Degré de pureté :Min. 95%Masse moléculaire :5,801.7 g/molIL-1β (178-207) (human)
CAS :<p>Please enquire for more information about IL-1beta (178-207) (human) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C157H256N38O49SDegré de pureté :Min. 95%Masse moléculaire :3,492.01 g/molProcathepsin B (26-50) (rat)
CAS :<p>Please enquire for more information about Procathepsin B (26-50) (rat) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C123H198N34O33SDegré de pureté :Min. 95%Masse moléculaire :2,713.16 g/molAcetyl-PACAP-38 (human, mouse, ovine, porcine, rat) trifluoroacetate salt
CAS :<p>Please enquire for more information about Acetyl-PACAP-38 (human, mouse, ovine, porcine, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C205H333N63O54SDegré de pureté :Min. 95%Masse moléculaire :4,576.3 g/mol(Des-Bromo)-Neuropeptide B (1-23) (human) trifluoroacetate salt
CAS :<p>Please enquire for more information about (Des-Bromo)-Neuropeptide B (1-23) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C107H162N30O30Degré de pureté :Min. 95%Masse moléculaire :2,348.62 g/molAdenine sulfate dihydrate
CAS :<p>Adenine sulfate dihydrate is an important component of the energy-producing process in mitochondria. Adenine sulfate dihydrate is a necessary cofactor for many metabolic reactions, including those that produce ATP and NADH. It has been shown to promote growth factor activity and stimulate cell proliferation. Adenine sulfate dihydrate can be used as a nutrient solution in recombinant protein production, where it is required for the expression of recombinant proteins in E. coli or mammalian cells. This compound also plays an important role in the glycosylation of proteins during their synthesis on ribosomes and may have implications for protein folding and stability.</p>Formule :(C5H5N5)2•(H2O)2•H2SO4Degré de pureté :Min. 95%Couleur et forme :PowderMasse moléculaire :404.36 g/molObestatin (human) trifluoroacetate salt
CAS :<p>Please enquire for more information about Obestatin (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C116H176N32O33Degré de pureté :Min. 95%Masse moléculaire :2,546.83 g/molpTH (7-84) (human) trifluoroacetate salt
<p>Please enquire for more information about pTH (7-84) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C381H629N119O115S2Degré de pureté :Min. 95%Masse moléculaire :8,780.94 g/mol5-FAM-Amylin (mouse, rat) trifluoroacetate salt
CAS :<p>Please enquire for more information about 5-FAM-Amylin (mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C188H282N52O59S2Degré de pureté :Min. 95%Masse moléculaire :4,278.7 g/molDnp-Pro-TNF-α (71-82) amide (human) trifluoroacetate salt
CAS :<p>Please enquire for more information about Dnp-Pro-TNF-alpha (71-82) amide (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C57H94N22O21Degré de pureté :Min. 95%Masse moléculaire :1,423.49 g/mol(Tyr15)-Fibrinopeptide B (human)
CAS :<p>Fibrinopeptide B is a linear peptide that is found in the human fibrinogen molecule. It has been shown to be bioactive and can be used as a specific molecular marker for thrombus formation. Fibrinopeptide B has an optimal wavelength of 280 nm, and can be detected using phosphoric acid-based electrophoresis. The peptides are typically only 10 to 20 amino acids long, although the length varies depending on the protein they are derived from.</p>Formule :C75H102N20O27Degré de pureté :Min. 95%Masse moléculaire :1,715.73 g/molC-Peptide (human) trifluoroacetate salt
CAS :<p>C-Peptide is a monoclonal antibody that binds to the β-cell and inhibits insulin release. It has been used in diagnosis of type 1 diabetes mellitus. C-Peptide is a hormone that regulates blood glucose levels by controlling the rate of glucose production in the liver, as well as by inhibiting the breakdown of glycogen in the liver. The C-terminal amino acid sequence Glu-Ala-Glu-Asp-Leu-Gln-Val-Gly-Gln-Val-Glu -Leu-Gly can be cleaved from the peptide by trifluoroacetic acid to yield free Gln, which can then be detected using mass spectrometry. Growth factors such as IGF1, FGF21, and HGF have been shown to increase C peptide levels in diabetic patients.</p>Formule :C129H211N35O48Degré de pureté :Min. 95%Masse moléculaire :3,020.26 g/molAcetyl-ACTH (2-24) (human, bovine, rat) trifluoroacetate salt
CAS :<p>Please enquire for more information about Acetyl-ACTH (2-24) (human, bovine, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C135H207N39O30SDegré de pureté :Min. 95%Masse moléculaire :2,888.4 g/mol(Phe1,Ser2,Tyr6)-PAR-1 (1-6) amide (human) trifluoroacetate salt
CAS :<p>Please enquire for more information about (Phe1,Ser2,Tyr6)-PAR-1 (1-6) amide (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C39H60N10O8Degré de pureté :Min. 95%Masse moléculaire :796.96 g/molIL-1α (223-250) (human)
CAS :<p>Please enquire for more information about IL-1alpha (223-250) (human) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C158H219N37O44Degré de pureté :Min. 95%Masse moléculaire :3,340.65 g/molPlatelet Factor 4 (58-70) (human)
CAS :<p>Please enquire for more information about Platelet Factor 4 (58-70) (human) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C76H133N17O18Degré de pureté :Min. 95%Masse moléculaire :1,572.97 g/mol(+)-Diisopropyl L-tartrate
CAS :<p>(+)-Diisopropyl L-tartrate is a chiral, hydrophobic, synthetic chemical that is soluble in organic solvents. It has been used as an intermediate for the synthesis of other compounds such as aldehydes and threonine. (+)-Diisopropyl L-tartrate is also used to separate mixtures of enantiomers. This compound has been shown to be effective at extracting styrene from gasoline or methyl esters from crude oil. The optimal extraction temperature is between 60°C and 100°C.</p>Formule :C10H18O6Degré de pureté :Min. 95%Couleur et forme :Clear LiquidMasse moléculaire :234.25 g/molCalcium chloride dihydrate
CAS :<p>Calcium chloride dihydrate is a chemical compound that is used in the preparation of buffers, as well as in polymer synthesis and analytical chemistry. It is also used in the treatment of low blood calcium levels, which may occur from chronic kidney failure, malnutrition or malabsorption. Calcium chloride dihydrate has been shown to inhibit the proliferation of various cancer cells, including prostate cancer cells. This inhibition has been shown to be due to its ability to significantly cytotoxic effects on these cells. The cytotoxicity was found to be due to lysosomal membrane permeabilization and Ca2+ influx into the cell leading to apoptosis induction.</p>Formule :CaCl2•(H2O)2Degré de pureté :Min. 95%Couleur et forme :White Clear LiquidMasse moléculaire :147.01 g/molAcetyl-Neurotrophin Receptor (368-381) amide (human)
CAS :<p>Please enquire for more information about Acetyl-Neurotrophin Receptor (368-381) amide (human) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C69H124N22O19Degré de pureté :Min. 95%Masse moléculaire :1,565.86 g/molLithium bis(oxalato)borate
CAS :<p>Lithium bis(oxalato)borate (LBBO), also known as Lithiumbis(oxalato)borate, is a lithium salt of the borate ester. The optimum concentration for LBBO is 1-2 mol/L. LBBO is soluble in water and reacts with glycol esters to form lithium glycolates. This reaction is reversible and the equilibrium can be shifted by changing the temperature or pressure. The NMR spectra of LBBO show a peak at 3.3 ppm which corresponds to the carbon atom attached to the carbonyl group, which is indicative of an organic solution.<br>LBBO has been shown to be an electrolyte for lithium ion batteries but it has not been studied extensively because it decomposes at temperatures above 400°C and exhibits poor transport properties, limiting its application in electronic devices.</p>Formule :C4BO8•LiDegré de pureté :Min. 95%Masse moléculaire :193.79 g/molC5a Anaphylatoxin (human) trifluoroacetate salt )
CAS :<p>Please enquire for more information about C5a Anaphylatoxin (human) trifluoroacetate salt ) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C350H578N108O107S8Degré de pureté :Min. 95%Masse moléculaire :8,267.53 g/molExperimental Allergic Encephalitogenic Peptide (human)
CAS :<p>Experimental Allergic Encephalitogenic Peptide (human) H-Phe-Ser-Trp-Gly-Ala-Glu-Gly-Gln-Arg-OH is a protein that is used as an adjuvant to increase the immune response. It is composed of a string of amino acids that are recognized by the immune system, but do not elicit an immune response on their own. The peptide can be administered intracutaneously or in the form of a vaccine. This peptide has been shown to have a basic nature and has been found to have lethal effects when administered at high doses.</p>Formule :C46H64N14O14Degré de pureté :Min. 95%Masse moléculaire :1,037.09 g/molAlarin (rat) trifluoroacetate salt
CAS :<p>Please enquire for more information about Alarin (rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C119H199N45O35Degré de pureté :Min. 95%Masse moléculaire :2,820.14 g/molTyrosinase (243-251) (human) acetate salt
CAS :<p>H-KCDICTDEY-OH peptide, corresponding to amino acids 243-251 of human Tyrosinase. The peptide is supplied as an acetate salt.</p>Formule :C44H68N10O18S2Degré de pureté :Min. 95%Masse moléculaire :1,089.2 g/molEuropium tris[3-(heptafluoropropylhydroxymethylene)-(+)-camphorate]
CAS :<p>Europium Tris[3-(Heptafluoropropylhydroxymethylene)-(+)-Camphorate] is a chiral compound that can be used as a catalyst for the asymmetric synthesis of spiroketals. The catalyst is immobilized on a monolayer and has been shown to work with nitrogen nucleophiles such as ammonia and amines. It also shows catalytic activity in hydrosilylation reactions, which are used in the production of polymers. Europium Tris[3-(Heptafluoropropylhydroxymethylene)-(+)-Camphorate] is soluble in organic solvents such as ethyl diazoacetate, styrene, and tetrahydrofuran.</p>Formule :C42H42EuF21O6Degré de pureté :Min. 95%Masse moléculaire :1,193.71 g/mol(Gly1,Ser3·22,Gln4·34,Thr6,Arg19,Tyr21,Ala23·31, Aib 32)-Pancreatic Polypeptide (human) trifluoroacetate salt
CAS :<p>Please enquire for more information about (Gly1,Ser3·22,Gln4·34,Thr6,Arg19,Tyr21,Ala23·31, Aib 32)-Pancreatic Polypeptide (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C183H281N57O54S2Degré de pureté :Min. 95%Masse moléculaire :4,207.67 g/molOxalic acid dihydrate
CAS :<p>Oxalic acid dihydrate is an organic compound with the molecular formula of (C2H2O4)2. It has a molecular weight of 226.07 g/mol and a melting point of 173°C. The intermolecular hydrogen bonding between the hydroxyl groups and the fatty acid chains creates an oxalic acid molecule that is able to exist in two different structures, alpha and beta. Alpha oxalic acid molecules have a particle phase transition temperature of -10°C, while beta oxalic acid molecules have a particle phase transition temperature of 30°C. Oxalic acid dihydrate is soluble in n-dimethylformamide (DMF) and hydrochloric acid (HCl). br>br> Oxalic acid dihydrate is used as an additive in metal-working fluids, which are used during machining processes to prevent corrosion. It also acts as a catalyst for transfer reactions between phosphorus pentoxide</p>Formule :C2H2O4•(H2O)2Degré de pureté :Min. 95%Masse moléculaire :126.07 g/mol1-Benzyl-3-piperidone HCl hydrate
CAS :<p>1-Benzyl-3-piperidone HCl hydrate is a synthetic organic compound that is used as a neutralizing agent in industrial processes. It is typically used in the extraction of metal ions from an acid solution, although it can also be used as a catalyst for chemical reactions. The neutralization reaction product, 1-benzyl-3-piperidone, has been reported to have significant antibacterial activity. The use of 1-benzyl-3-piperidone HCl hydrate may be limited by its high cost and toxicity.</p>Formule :C12H15NO·HCl·xH2ODegré de pureté :Min. 95%Couleur et forme :PowderMasse moléculaire :225.71 g/mol
