Anticorps primaires

The CDK2 antibody is a monoclonal antibody that specifically targets the cyclin-dependent kinase 2 (CDK2) protein. This antibody has been extensively studied in the field of Life Sciences and has shown promising results in various research applications. It has been found to be effective in inhibiting the growth of hepatocyte, promoting natriuretic activity, and regulating fibrinogen activation. The CDK2 antibody is also known for its histidine glycosylation properties, which enhance its stability and binding affinity. Additionally, this antibody has been used in the detection and quantification of autoantibodies and steroids. With its high specificity and reliability, the CDK2 antibody is a valuable tool for researchers in need of accurate and precise measurements in their studies.

FANCM antibody was raised in Rabbit using Human FANCM as the immunogen

AHSG antibody was raised in Rabbit using Human AHSG as the immunogen

The MCM3 antibody is a monoclonal antibody that specifically targets the growth factor MCM3. It acts as a neutralizing agent, inhibiting the activity of MCM3 and preventing its activation. This antibody has been widely used in Life Sciences research, particularly in studies involving trastuzumab, an anti-HER2 antibody. By blocking the interaction between MCM3 and epidermal growth factor receptors, this antibody effectively disrupts signaling pathways involved in cell growth and proliferation.

Rabbit polyclonal RAB1B antibody

Rabbit polyclonal DLG2 antibody

The GSTT1 antibody is a highly specific monoclonal antibody that targets the glutathione S-transferase theta 1 (GSTT1) protein. This antibody is commonly used in Life Sciences research to study the role of GSTT1 in various biological processes.

GCK antibody was raised in rabbit using the N terminal of GCK as the immunogen

KCNIP4 antibody was raised in Rabbit using Human KCNIP4 as the immunogen

GABRD antibody was raised in rabbit using the N terminal of GABRD as the immunogen

LOX antibody was raised in Rabbit using Human LOX as the immunogen

MTO1 antibody was raised in Rabbit using Human MTO1 as the immunogen

Affinity purified Rabbit polyclonal ACMSD antibody

Rabbit polyclonal SEC11A antibody

Mouse monoclonal PANK2 antibody

TRIM59 antibody was raised using the middle region of TRIM59 corresponding to a region with amino acids LEKVDDVRQHVQILKQRPLPEVQPVEIYPRVSKILKEEWSRTEIGQIKNV

DCLK1 antibody was raised in Rabbit using Human DCLK1 as the immunogen

The CD5 antibody is a monoclonal antibody that targets CD20, a glycoprotein expressed on the surface of B cells. It is widely used in the field of life sciences for research purposes. The CD5 antibody acts as an inhibitor by binding to CD20 and preventing its interaction with other molecules, thus inhibiting B cell activation and proliferation. This antibody can be immobilized on various surfaces for use in assays or experiments. It has been shown to have chemokine-like properties and can induce apoptosis in certain cancer cell lines, such as MCF-7. Additionally, the CD5 antibody can be used in combination with recombinant proteins or other antibodies to create antibody-drug conjugates or for targeted therapy. Its versatility and specificity make it a valuable tool in the field of protein research and drug development.

The SERPINB13 antibody is a highly specialized colloidal antibody that belongs to the class of neurotrophic monoclonal antibodies. It is widely used in the field of Life Sciences for various applications. This antibody specifically targets and binds to SERPINB13, a protein involved in regulating ferritin, phosphatase, glucagon, and growth factor levels. The SERPINB13 antibody has both acidic and neutralizing properties, making it suitable for a range of research purposes. Its high specificity and affinity ensure accurate detection and quantification of SERPINB13 in various biological samples. With its exceptional performance and reliability, this monoclonal antibody is an essential tool for scientists working in diverse research areas.

DDX50 antibody was raised using a synthetic peptide corresponding to a region with amino acids EESESQKKERQKSDRRKSRHHYDSDEKSETRENGVTDDLDAPKAKKSKMK